Detailed information NTG0233273

Bioinformatically predicted

Overview

• Name: comX/sigX
• Type: Regulator
• Locus tag: CDH84_RS10500
• Genome accession: NZ_CP021771
• Coordinates: 1992244..1992723 (+)
• Length: 159 a.a.
• NCBI ID: WP_001204194.1
• Uniprot ID: A0AAV3JNR5
• Organism: Streptococcus agalactiae strain B507
• Function: activate transcription of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	1980040..1992723	1992244..1992723	within	0

Gene organization within MGE regions

Location: 1980040..1992723

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CDH84_RS10420 (CDH84_10305)	-	1980040..1981263 (-)	1224	WP_001003103.1	FRG domain-containing protein	-
CDH84_RS10425 (CDH84_10310)	-	1981329..1982462 (-)	1134	WP_001007677.1	site-specific integrase	-
CDH84_RS10430 (CDH84_10315)	-	1982467..1982661 (-)	195	WP_000562208.1	DUF3173 family protein	-
CDH84_RS10435 (CDH84_10320)	-	1982730..1984076 (-)	1347	WP_000088102.1	Rep family protein	-
CDH84_RS10440 (CDH84_10325)	-	1984415..1984774 (-)	360	WP_025194534.1	hypothetical protein	-
CDH84_RS10445 (CDH84_10330)	-	1984789..1985127 (-)	339	WP_000092752.1	hypothetical protein	-
CDH84_RS10450 (CDH84_10335)	-	1985377..1985832 (+)	456	WP_000021848.1	helix-turn-helix domain-containing protein	-
CDH84_RS10455 (CDH84_10340)	-	1986130..1987259 (+)	1130	Protein_1923	IS3 family transposase	-
CDH84_RS10460 (CDH84_10345)	-	1987347..1987679 (-)	333	WP_000181338.1	hypothetical protein	-
CDH84_RS10465 (CDH84_10350)	-	1987690..1988097 (-)	408	WP_000351058.1	helix-turn-helix transcriptional regulator	-
CDH84_RS10470 (CDH84_10355)	-	1988353..1988667 (+)	315	Protein_1926	transposase	-
CDH84_RS11250	-	1989267..1989698 (+)	432	WP_000761053.1	hypothetical protein	-
CDH84_RS11115 (CDH84_10370)	-	1989768..1989938 (+)	171	WP_000840973.1	hypothetical protein	-
CDH84_RS10490 (CDH84_10375)	-	1990854..1991405 (+)	552	WP_000161843.1	nucleotidyltransferase family protein	-
CDH84_RS10495 (CDH84_10380)	-	1991625..1992044 (+)	420	WP_000784700.1	YjdF family protein	-
CDH84_RS10500 (CDH84_10385)	comX/sigX	1992244..1992723 (+)	480	WP_001204194.1	sigma-70 family RNA polymerase sigma factor	Regulator

Sequence

Protein

• Length: 159 a.a.
• Molecular weight: 19447.28 Da
• Isoelectric Point: 6.2639

>NTDB_id=233273 CDH84_RS10500 WP_001204194.1 1992244..1992723(+) (comX/sigX) [Streptococcus agalactiae strain B507]
MRDFEELFDKVKPIVMKLRRNYFVQLWEYDDWIQEGRIVLFRLLEEHPYLLDNESKLFIYFKTKFSNYLNDVLRHQDCQK
RQFNKMPYEEISEVSHYVKSKGLVLDDYIAYRDTLTKVEETLSDIDKEKFEKLISGERFAGKKQFIRDIQPFFNAFKAD

Nucleotide

• Length: 480 bp

>NTDB_id=233273 CDH84_RS10500 WP_001204194.1 1992244..1992723(+) (comX/sigX) [Streptococcus agalactiae strain B507]
TTGAGAGATTTTGAGGAGTTGTTTGATAAAGTAAAGCCAATCGTAATGAAGCTGAGAAGAAATTATTTTGTTCAACTTTG
GGAATATGATGATTGGATTCAAGAAGGACGTATTGTACTTTTTAGGTTGCTTGAAGAGCATCCGTATTTATTGGATAATG
AAAGCAAACTATTCATTTACTTTAAAACAAAATTTTCAAATTATTTAAACGATGTATTAAGACACCAAGATTGTCAAAAG
CGACAATTTAATAAAATGCCTTATGAAGAAATCAGTGAAGTTAGTCACTATGTTAAGAGTAAAGGACTAGTTTTAGATGA
CTATATTGCTTATCGTGATACTTTAACAAAAGTGGAAGAAACTTTGTCAGATATTGATAAAGAAAAATTTGAAAAACTGA
TTAGTGGTGAACGTTTTGCGGGGAAGAAACAATTCATACGAGATATTCAACCTTTTTTCAATGCTTTTAAAGCGGATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	56.688	98.742	0.56
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	52.349	93.711	0.491
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	52.349	93.711	0.491
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	52.349	93.711	0.491
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	52.349	93.711	0.491
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	52	94.34	0.491
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	52	94.34	0.491
comX/sigX	Streptococcus mutans UA159	49.677	97.484	0.484
comX	Streptococcus sobrinus strain NIDR 6715-7	43.59	98.113	0.428
comX/sigX	Streptococcus suis D9	43.226	97.484	0.421
comX/sigX	Streptococcus suis isolate S10	43.226	97.484	0.421
comX/sigX	Streptococcus suis P1/7	43.226	97.484	0.421
comX	Streptococcus thermophilus LMD-9	42.177	92.453	0.39
comX	Streptococcus thermophilus LMG 18311	42.177	92.453	0.39
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	39.869	96.226	0.384
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	39.869	96.226	0.384
comX/sigX/comX2/sigX2	Streptococcus mitis SK321	39.869	96.226	0.384
comX/comX2	Streptococcus pneumoniae Rx1	40.397	94.969	0.384
comX/comX2	Streptococcus pneumoniae TIGR4	40.397	94.969	0.384
comX/comX1	Streptococcus pneumoniae TIGR4	40.397	94.969	0.384
comX/comX1	Streptococcus pneumoniae Rx1	40.397	94.969	0.384
comX/comX2	Streptococcus pneumoniae D39	40.397	94.969	0.384
comX/comX1	Streptococcus pneumoniae D39	40.397	94.969	0.384
comX/comX2	Streptococcus pneumoniae R6	40.397	94.969	0.384
comX/comX1	Streptococcus pneumoniae R6	40.397	94.969	0.384
comX/sigX/comX1/sigX1	Streptococcus mitis SK321	39.216	96.226	0.377
comX/sigX/comX2/sigX2	Streptococcus mitis NCTC 12261	39.216	96.226	0.377
comX	Streptococcus salivarius SK126	40.816	92.453	0.377
comX/sigX	Streptococcus salivarius strain HSISS4	40.816	92.453	0.377
comX/sigX/comX1/sigX1	Streptococcus mitis NCTC 12261	38.562	96.226	0.371