Detailed information NTG0168946

Bioinformatically predicted

Overview

• Name: pilA/pilAI
• Type: Machinery gene
• Locus tag: PcP3B5_RS30525
• Genome accession: NZ_CP014158
• Coordinates: 1145367..1145786 (+)
• Length: 139 a.a.
• NCBI ID: WP_082816254.1
• Uniprot ID: -
• Organism: Pseudomonas citronellolis strain P3B5
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1140452..1150769	1145367..1145786	within	0

Gene organization within MGE regions

Location: 1140452..1150769

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PcP3B5_RS05260 (PcP3B5_10720)	yacG	1140452..1140661 (-)	210	WP_043272268.1	DNA gyrase inhibitor YacG	-
PcP3B5_RS05265 (PcP3B5_10730)	coaE	1140658..1141266 (-)	609	WP_009617624.1	dephospho-CoA kinase	-
PcP3B5_RS05270 (PcP3B5_10740)	pilD	1141340..1142212 (-)	873	WP_061560723.1	prepilin peptidase	Machinery gene
PcP3B5_RS05275 (PcP3B5_10750)	pilC	1142213..1143430 (-)	1218	WP_061560724.1	type II secretion system F family protein	Machinery gene
PcP3B5_RS05280 (PcP3B5_10760)	pilB	1143434..1145137 (-)	1704	WP_061560725.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PcP3B5_RS30525	pilA/pilAI	1145367..1145786 (+)	420	WP_082816254.1	pilin	Machinery gene
PcP3B5_RS30530 (PcP3B5_10770)	-	1145951..1147945 (+)	1995	WP_145923854.1	sulfatase-like hydrolase/transferase	-
PcP3B5_RS05295 (PcP3B5_10790)	-	1148321..1149325 (+)	1005	WP_420820162.1	diguanylate cyclase	-
PcP3B5_RS05300 (PcP3B5_10800)	-	1149322..1150518 (-)	1197	WP_061560728.1	type II toxin-antitoxin system HipA family toxin	-
PcP3B5_RS05305 (PcP3B5_10810)	-	1150518..1150769 (-)	252	WP_043318092.1	helix-turn-helix transcriptional regulator	-

Sequence

Protein

• Length: 139 a.a.
• Molecular weight: 14236.07 Da
• Isoelectric Point: 4.9810

>NTDB_id=168946 PcP3B5_RS30525 WP_082816254.1 1145367..1145786(+) (pilA/pilAI) [Pseudomonas citronellolis strain P3B5]
MKAQKGFTLIELMIVVAIIGILAAIALPAYQDYTVRSQAAAALSEITPGKTAFEVAVNEGKTPSTTATDNGYIGVPATTT
YCSVAVTATTIACTTRGGNAANFNGETITWTRDADDGTWTCSTTLAAKYRPGSCGAAGS

Nucleotide

• Length: 420 bp

>NTDB_id=168946 PcP3B5_RS30525 WP_082816254.1 1145367..1145786(+) (pilA/pilAI) [Pseudomonas citronellolis strain P3B5]
ATGAAGGCTCAAAAAGGCTTCACCCTTATCGAGTTGATGATCGTGGTCGCGATCATCGGTATTCTGGCTGCAATCGCCCT
GCCGGCCTATCAGGATTACACCGTACGTTCCCAGGCTGCCGCGGCCCTTTCCGAAATCACCCCCGGGAAAACCGCATTTG
AAGTCGCTGTGAATGAAGGTAAGACTCCCTCGACCACTGCTACTGATAATGGTTATATTGGTGTGCCTGCAACTACCACC
TACTGCTCGGTAGCGGTTACCGCAACTACTATCGCTTGTACTACTAGGGGTGGTAATGCAGCTAATTTCAATGGTGAAAC
TATTACTTGGACCCGTGATGCTGATGATGGTACTTGGACTTGCAGCACTACGCTTGCCGCCAAATATCGTCCGGGTAGTT
GCGGTGCAGCTGGTAGCTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

• Pilin (bacterial filament) (Pilin) (35-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA/pilAI	Pseudomonas stutzeri DSM 10701	68.345	100	0.683
pilA/pilAII	Pseudomonas stutzeri DSM 10701	59.398	95.683	0.568
pilA2	Legionella pneumophila strain ERS1305867	48.529	97.842	0.475
pilA2	Legionella pneumophila str. Paris	48.529	97.842	0.475
pilA	Acinetobacter baumannii strain A118	45.775	100	0.468
comP	Acinetobacter baylyi ADP1	42.384	100	0.46
pilA	Ralstonia pseudosolanacearum GMI1000	38.889	100	0.453
pilA	Pseudomonas aeruginosa PAK	41.611	100	0.446
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	41.259	100	0.424
pilA	Vibrio cholerae C6706	41.259	100	0.424
pilA	Vibrio cholerae strain A1552	41.259	100	0.424
pilE	Neisseria gonorrhoeae strain FA1090	35.032	100	0.396
pilA	Haemophilus influenzae Rd KW20	39.855	99.281	0.396
pilA	Haemophilus influenzae 86-028NP	39.13	99.281	0.388
pilA	Vibrio parahaemolyticus RIMD 2210633	38.519	97.122	0.374