Detailed information
Bioinformatically predicted
Overview
| Name | comX/sigX | Type | Regulator |
| Locus tag | APQ97_RS00530 | Genome accession | NZ_CP012911 |
| Coordinates | 84474..84944 (+) | Length | 156 a.a. |
| NCBI ID | WP_002936602.1 | Uniprot ID | A0A075SE61 |
| Organism | Streptococcus suis strain NSUI060 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 82024..151668 | 84474..84944 | within | 0 |
| IScluster/Tn | 82024..84267 | 84474..84944 | flank | 207 |
Gene organization within MGE regions
Location: 82024..151668
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APQ97_RS00515 (APQ97_00515) | - | 82024..83280 (+) | 1257 | WP_002936184.1 | ISL3-like element ISSsu6 family transposase | - |
| APQ97_RS11595 | - | 83412..84267 (+) | 856 | Protein_89 | IS982 family transposase | - |
| APQ97_RS00530 (APQ97_00530) | comX/sigX | 84474..84944 (+) | 471 | WP_002936602.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| APQ97_RS00635 (APQ97_00635) | mreC | 92246..93082 (+) | 837 | WP_002935340.1 | rod shape-determining protein MreC | - |
| APQ97_RS00640 (APQ97_00640) | mreD | 93099..93587 (+) | 489 | WP_009908846.1 | rod shape-determining protein MreD | - |
| APQ97_RS00645 (APQ97_00645) | - | 93672..94928 (+) | 1257 | WP_002935338.1 | CHAP domain-containing protein | - |
| APQ97_RS00650 (APQ97_00650) | - | 95031..95999 (+) | 969 | WP_002935337.1 | ribose-phosphate diphosphokinase | - |
| APQ97_RS00655 (APQ97_00655) | - | 96086..97264 (+) | 1179 | WP_002935336.1 | pyridoxal phosphate-dependent aminotransferase | - |
| APQ97_RS00660 (APQ97_00660) | recO | 97251..98033 (+) | 783 | WP_002935335.1 | DNA repair protein RecO | - |
| APQ97_RS00665 (APQ97_00665) | plsX | 98030..99037 (+) | 1008 | WP_002935334.1 | phosphate acyltransferase PlsX | - |
| APQ97_RS00670 (APQ97_00670) | - | 99030..99278 (+) | 249 | WP_002935333.1 | phosphopantetheine-binding protein | - |
| APQ97_RS00675 (APQ97_00675) | purC | 99396..100103 (+) | 708 | WP_002935328.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| APQ97_RS00680 (APQ97_00680) | - | 100116..103835 (+) | 3720 | WP_002935327.1 | phosphoribosylformylglycinamidine synthase | - |
| APQ97_RS00685 (APQ97_00685) | purF | 103838..105292 (+) | 1455 | WP_002935326.1 | amidophosphoribosyltransferase | - |
| APQ97_RS00690 (APQ97_00690) | purM | 105348..106370 (+) | 1023 | WP_002935325.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| APQ97_RS00695 (APQ97_00695) | purN | 106367..106918 (+) | 552 | WP_002935324.1 | phosphoribosylglycinamide formyltransferase | - |
| APQ97_RS00700 (APQ97_00700) | purH | 106928..108475 (+) | 1548 | WP_002935323.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| APQ97_RS00705 (APQ97_00705) | - | 108540..109370 (+) | 831 | WP_002935322.1 | DNA adenine methylase | - |
| APQ97_RS00710 (APQ97_00710) | - | 109360..110175 (+) | 816 | WP_032499218.1 | site-specific DNA-methyltransferase | - |
| APQ97_RS00715 (APQ97_00715) | - | 110153..111079 (+) | 927 | WP_002935320.1 | type II restriction endonuclease | - |
| APQ97_RS00720 (APQ97_00720) | - | 111079..111984 (+) | 906 | WP_002935319.1 | type II restriction endonuclease | - |
| APQ97_RS00725 (APQ97_00725) | purD | 112105..113367 (+) | 1263 | WP_002935318.1 | phosphoribosylamine--glycine ligase | - |
| APQ97_RS00730 (APQ97_00730) | purE | 113393..113881 (+) | 489 | WP_002935317.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| APQ97_RS00735 (APQ97_00735) | purK | 113868..114953 (+) | 1086 | WP_002935314.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| APQ97_RS00740 (APQ97_00740) | - | 114940..115863 (+) | 924 | WP_002935313.1 | DUF4268 domain-containing protein | - |
| APQ97_RS00745 (APQ97_00745) | purB | 115898..117190 (+) | 1293 | WP_002935312.1 | adenylosuccinate lyase | - |
| APQ97_RS00750 (APQ97_00750) | - | 117699..118523 (+) | 825 | WP_002935311.1 | ABC transporter ATP-binding protein | - |
| APQ97_RS00755 (APQ97_00755) | - | 118516..119250 (+) | 735 | WP_002935310.1 | ABC transporter permease | - |
| APQ97_RS00760 (APQ97_00760) | - | 119585..120313 (+) | 729 | WP_002935309.1 | hypothetical protein | - |
| APQ97_RS00765 (APQ97_00765) | - | 120323..120901 (+) | 579 | WP_002935308.1 | CPBP family intramembrane glutamic endopeptidase | - |
| APQ97_RS00770 (APQ97_00770) | - | 120916..121344 (+) | 429 | WP_053866406.1 | Msa family membrane protein | - |
| APQ97_RS00775 (APQ97_00775) | - | 121337..122209 (+) | 873 | WP_002935305.1 | ABC transporter ATP-binding protein | - |
| APQ97_RS00780 (APQ97_00780) | - | 122215..122985 (+) | 771 | WP_002935304.1 | membrane protein | - |
| APQ97_RS00785 (APQ97_00785) | - | 122988..124700 (+) | 1713 | WP_002935303.1 | ABC transporter ATP-binding protein | - |
| APQ97_RS12510 | - | 124802..124975 (+) | 174 | WP_002935301.1 | hypothetical protein | - |
| APQ97_RS00790 (APQ97_00790) | ruvB | 125270..126271 (+) | 1002 | WP_002935300.1 | Holliday junction branch migration DNA helicase RuvB | - |
| APQ97_RS00795 (APQ97_00795) | - | 126271..127017 (+) | 747 | WP_002935299.1 | GNAT family N-acetyltransferase | - |
| APQ97_RS00800 (APQ97_00800) | - | 127019..127657 (+) | 639 | WP_002935298.1 | HAD-IA family hydrolase | - |
| APQ97_RS00805 (APQ97_00805) | comR | 127904..128821 (+) | 918 | WP_002935296.1 | helix-turn-helix domain-containing protein | Regulator |
| APQ97_RS00810 (APQ97_00810) | - | 129230..130432 (-) | 1203 | WP_002935295.1 | IS110-like element ISSsu7 family transposase | - |
| APQ97_RS00815 (APQ97_00815) | - | 130679..131386 (+) | 708 | Protein_128 | amino acid ABC transporter permease | - |
| APQ97_RS00820 (APQ97_00820) | - | 131386..132129 (+) | 744 | WP_013730659.1 | amino acid ABC transporter ATP-binding protein | - |
| APQ97_RS00825 (APQ97_00825) | nrdD | 132435..134606 (+) | 2172 | WP_002939131.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| APQ97_RS12770 (APQ97_00830) | - | 134699..134833 (+) | 135 | WP_002939130.1 | hypothetical protein | - |
| APQ97_RS00835 (APQ97_00835) | - | 134835..136181 (+) | 1347 | WP_009910991.1 | 5'-nucleotidase C-terminal domain-containing protein | - |
| APQ97_RS00840 (APQ97_00840) | - | 136183..136677 (+) | 495 | WP_002939125.1 | GNAT family N-acetyltransferase | - |
| APQ97_RS00850 (APQ97_00850) | nrdG | 136864..137421 (+) | 558 | WP_002939123.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
| APQ97_RS00865 (APQ97_00860) | - | 137902..139188 (-) | 1287 | WP_002939120.1 | replication-associated recombination protein A | - |
| APQ97_RS00870 (APQ97_00865) | - | 139262..139732 (+) | 471 | WP_002939116.1 | DUF3013 family protein | - |
| APQ97_RS00875 (APQ97_00870) | - | 139734..140087 (+) | 354 | WP_009910982.1 | ASCH domain-containing protein | - |
| APQ97_RS00880 (APQ97_00875) | prmA | 140683..141636 (+) | 954 | WP_002939103.1 | 50S ribosomal protein L11 methyltransferase | - |
| APQ97_RS00885 (APQ97_00880) | - | 141638..142384 (+) | 747 | WP_002939095.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| APQ97_RS00890 (APQ97_00885) | - | 142398..143660 (+) | 1263 | WP_002939093.1 | hypothetical protein | - |
| APQ97_RS12500 (APQ97_00890) | - | 143670..144385 (+) | 716 | Protein_141 | DUF554 domain-containing protein | - |
| APQ97_RS00900 (APQ97_00895) | - | 144626..145183 (+) | 558 | WP_002939087.1 | hypothetical protein | - |
| APQ97_RS00905 (APQ97_00900) | - | 145413..146669 (+) | 1257 | WP_002936184.1 | ISL3-like element ISSsu6 family transposase | - |
| APQ97_RS00910 (APQ97_00905) | - | 146727..149203 (-) | 2477 | Protein_144 | bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase | - |
| APQ97_RS00915 (APQ97_00910) | - | 149467..151668 (+) | 2202 | WP_024394201.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 19072.97 Da Isoelectric Point: 8.9339
>NTDB_id=158193 APQ97_RS00530 WP_002936602.1 84474..84944(+) (comX/sigX) [Streptococcus suis strain NSUI060]
MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEAQPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKR
KFDRMPHEDIHELSHAIQSPGLINDELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR
MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEAQPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKR
KFDRMPHEDIHELSHAIQSPGLINDELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR
Nucleotide
Download Length: 471 bp
>NTDB_id=158193 APQ97_RS00530 WP_002936602.1 84474..84944(+) (comX/sigX) [Streptococcus suis strain NSUI060]
ATGGAATTCGAAAAAGTGTACGCAAGCGTCAAAGGTATTGTAAATAAGGCTCGAAAAGAGTTTTACATTAAACTATGGGA
TCGAGATGATTGGGAACAAGAAGGAATGATGACCTTGTTTGAATTGTTGGAAGCTCAACCGTGGCTAGTTGATGAACAAG
TTCAATTATATTGTTATTTTAAAGTCAAGTTCAGAAATCGAATCAAGGATCGTATCCGCAAACAGGAAAGTCAAAAACGC
AAGTTTGACCGTATGCCACATGAAGATATTCACGAATTATCTCACGCAATACAATCACCGGGATTAATAAACGATGAACT
ATTAATGCTAAGAGGTGCCTTGAGAGATTATCGAAAAAATCTGAGTAATGATCAACTTGATAAATACGAAAAATTAATTA
GCGGACAATGTTTTAATGGTCGCCGTGAAATGATACGTGATTTACAAATTCATTTGAAAGACTTTCGCTAA
ATGGAATTCGAAAAAGTGTACGCAAGCGTCAAAGGTATTGTAAATAAGGCTCGAAAAGAGTTTTACATTAAACTATGGGA
TCGAGATGATTGGGAACAAGAAGGAATGATGACCTTGTTTGAATTGTTGGAAGCTCAACCGTGGCTAGTTGATGAACAAG
TTCAATTATATTGTTATTTTAAAGTCAAGTTCAGAAATCGAATCAAGGATCGTATCCGCAAACAGGAAAGTCAAAAACGC
AAGTTTGACCGTATGCCACATGAAGATATTCACGAATTATCTCACGCAATACAATCACCGGGATTAATAAACGATGAACT
ATTAATGCTAAGAGGTGCCTTGAGAGATTATCGAAAAAATCTGAGTAATGATCAACTTGATAAATACGAAAAATTAATTA
GCGGACAATGTTTTAATGGTCGCCGTGAAATGATACGTGATTTACAAATTCATTTGAAAGACTTTCGCTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.