Detailed information
Overview
| Name | comX/sigX | Type | Regulator |
| Locus tag | AA105_RS00085 | Genome accession | NZ_CP011419 |
| Coordinates | 16342..16812 (+) | Length | 156 a.a. |
| NCBI ID | WP_002936602.1 | Uniprot ID | A0A075SE61 |
| Organism | Streptococcus suis strain NSUI002 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 14046..58890 | 16342..16812 | within | 0 |
Gene organization within MGE regions
Location: 14046..58890
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AA105_RS00080 (AA105_00080) | ftsH | 14046..16016 (+) | 1971 | WP_004194314.1 | ATP-dependent zinc metalloprotease FtsH | - |
| AA105_RS00085 (AA105_00085) | comX/sigX | 16342..16812 (+) | 471 | WP_002936602.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| AA105_RS00190 (AA105_00190) | mreC | 24115..24951 (+) | 837 | WP_009908845.1 | rod shape-determining protein MreC | - |
| AA105_RS00195 (AA105_00195) | mreD | 24941..25456 (+) | 516 | WP_002935339.1 | rod shape-determining protein MreD | - |
| AA105_RS00200 (AA105_00200) | - | 25541..26797 (+) | 1257 | WP_002935338.1 | CHAP domain-containing protein | - |
| AA105_RS00205 (AA105_00205) | - | 26900..27865 (+) | 966 | WP_024409289.1 | ribose-phosphate diphosphokinase | - |
| AA105_RS00210 (AA105_00210) | - | 27956..29134 (+) | 1179 | WP_002935336.1 | pyridoxal phosphate-dependent aminotransferase | - |
| AA105_RS00215 (AA105_00215) | recO | 29121..29903 (+) | 783 | WP_002935335.1 | DNA repair protein RecO | - |
| AA105_RS00220 (AA105_00220) | plsX | 29900..30907 (+) | 1008 | WP_002935334.1 | phosphate acyltransferase PlsX | - |
| AA105_RS00225 (AA105_00225) | - | 30900..31148 (+) | 249 | WP_002935333.1 | phosphopantetheine-binding protein | - |
| AA105_RS00230 (AA105_00230) | purC | 31266..31973 (+) | 708 | WP_002935328.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| AA105_RS00235 (AA105_00235) | - | 31986..35705 (+) | 3720 | WP_009908856.1 | phosphoribosylformylglycinamidine synthase | - |
| AA105_RS00240 (AA105_00240) | purF | 35708..37162 (+) | 1455 | WP_009908857.1 | amidophosphoribosyltransferase | - |
| AA105_RS00245 (AA105_00245) | purM | 37218..38240 (+) | 1023 | WP_009908859.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| AA105_RS00250 (AA105_00250) | purN | 38237..38788 (+) | 552 | WP_009908860.1 | phosphoribosylglycinamide formyltransferase | - |
| AA105_RS00255 (AA105_00255) | purH | 38798..40345 (+) | 1548 | WP_002935323.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| AA105_RS00260 (AA105_00260) | - | 40410..41240 (+) | 831 | WP_002935322.1 | DNA adenine methylase | - |
| AA105_RS00265 (AA105_00265) | - | 41230..42045 (+) | 816 | WP_032499218.1 | site-specific DNA-methyltransferase | - |
| AA105_RS00270 (AA105_00270) | - | 42023..42949 (+) | 927 | WP_002935320.1 | type II restriction endonuclease | - |
| AA105_RS00275 (AA105_00275) | - | 42949..43854 (+) | 906 | WP_002935319.1 | type II restriction endonuclease | - |
| AA105_RS00280 (AA105_00280) | purD | 43975..45237 (+) | 1263 | WP_002935318.1 | phosphoribosylamine--glycine ligase | - |
| AA105_RS00285 (AA105_00285) | purE | 45263..45751 (+) | 489 | WP_009908864.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| AA105_RS00290 (AA105_00290) | purK | 45738..46823 (+) | 1086 | WP_002935314.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| AA105_RS00295 (AA105_00295) | - | 46810..47733 (+) | 924 | WP_002935313.1 | DUF4268 domain-containing protein | - |
| AA105_RS00300 (AA105_00300) | purB | 47768..49060 (+) | 1293 | WP_013730055.1 | adenylosuccinate lyase | - |
| AA105_RS00305 (AA105_00305) | - | 49572..50396 (+) | 825 | WP_002935311.1 | ABC transporter ATP-binding protein | - |
| AA105_RS00310 (AA105_00310) | - | 50389..51123 (+) | 735 | WP_002935310.1 | ABC transporter permease | - |
| AA105_RS00315 (AA105_00315) | - | 51458..52186 (+) | 729 | WP_002935309.1 | hypothetical protein | - |
| AA105_RS00320 (AA105_00320) | - | 52196..52774 (+) | 579 | WP_002935308.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AA105_RS00325 (AA105_00325) | - | 52789..53217 (+) | 429 | WP_002935307.1 | Msa family membrane protein | - |
| AA105_RS00330 (AA105_00330) | - | 53210..54082 (+) | 873 | WP_002935305.1 | ABC transporter ATP-binding protein | - |
| AA105_RS00335 (AA105_00335) | - | 54088..54858 (+) | 771 | WP_002935304.1 | membrane protein | - |
| AA105_RS00340 (AA105_00340) | - | 54861..56573 (+) | 1713 | WP_002935303.1 | ABC transporter ATP-binding protein | - |
| AA105_RS12055 | - | 56675..56848 (+) | 174 | WP_002935301.1 | hypothetical protein | - |
| AA105_RS00345 (AA105_00345) | ruvB | 57143..58144 (+) | 1002 | WP_002935300.1 | Holliday junction branch migration DNA helicase RuvB | - |
| AA105_RS00350 (AA105_00350) | - | 58144..58890 (+) | 747 | WP_002935299.1 | GNAT family N-acetyltransferase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 19072.97 Da Isoelectric Point: 8.9339
>NTDB_id=145856 AA105_RS00085 WP_002936602.1 16342..16812(+) (comX/sigX) [Streptococcus suis strain NSUI002]
MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEAQPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKR
KFDRMPHEDIHELSHAIQSPGLINDELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR
MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEAQPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKR
KFDRMPHEDIHELSHAIQSPGLINDELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR
Nucleotide
Download Length: 471 bp
>NTDB_id=145856 AA105_RS00085 WP_002936602.1 16342..16812(+) (comX/sigX) [Streptococcus suis strain NSUI002]
ATGGAATTCGAAAAAGTGTACGCAAGCGTCAAAGGTATTGTAAATAAGGCTCGAAAAGAGTTTTACATTAAACTATGGGA
TCGAGATGATTGGGAACAAGAAGGAATGATGACCTTGTTTGAATTGTTGGAAGCTCAACCGTGGCTAGTTGATGAACAAG
TTCAATTATATTGTTATTTTAAAGTCAAGTTCAGAAATCGAATCAAGGATCGTATCCGCAAACAGGAAAGTCAAAAACGC
AAGTTTGACCGTATGCCACATGAAGATATTCACGAATTATCTCACGCAATACAATCACCGGGATTAATAAACGATGAACT
ATTAATGCTAAGAGGTGCCTTGAGAGATTATCGAAAAAATCTGAGTAATGATCAACTTGATAAATACGAAAAATTAATTA
GCGGACAATGTTTTAATGGTCGCCGTGAAATGATACGTGATTTACAAATTCATTTGAAAGACTTTCGCTAA
ATGGAATTCGAAAAAGTGTACGCAAGCGTCAAAGGTATTGTAAATAAGGCTCGAAAAGAGTTTTACATTAAACTATGGGA
TCGAGATGATTGGGAACAAGAAGGAATGATGACCTTGTTTGAATTGTTGGAAGCTCAACCGTGGCTAGTTGATGAACAAG
TTCAATTATATTGTTATTTTAAAGTCAAGTTCAGAAATCGAATCAAGGATCGTATCCGCAAACAGGAAAGTCAAAAACGC
AAGTTTGACCGTATGCCACATGAAGATATTCACGAATTATCTCACGCAATACAATCACCGGGATTAATAAACGATGAACT
ATTAATGCTAAGAGGTGCCTTGAGAGATTATCGAAAAAATCTGAGTAATGATCAACTTGATAAATACGAAAAATTAATTA
GCGGACAATGTTTTAATGGTCGCCGTGAAATGATACGTGATTTACAAATTCATTTGAAAGACTTTCGCTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.