Detailed information
Bioinformatically predicted
Overview
| Name | comX/sigX | Type | Regulator |
| Locus tag | CUGBS08_RS00545 | Genome accession | NZ_CP010874 |
| Coordinates | 73474..73953 (+) | Length | 159 a.a. |
| NCBI ID | WP_001204194.1 | Uniprot ID | A0AAV3JNR5 |
| Organism | Streptococcus agalactiae strain CU_GBS_08 | ||
| Function | activate transcription of late competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 74132..115474 | 73474..73953 | flank | 179 |
Gene organization within MGE regions
Location: 73474..115474
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CUGBS08_RS00545 (CUGBS08_00111) | comX/sigX | 73474..73953 (+) | 480 | WP_001204194.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| CUGBS08_RS00550 (CUGBS08_00112) | - | 74132..75229 (-) | 1098 | WP_000570848.1 | site-specific integrase | - |
| CUGBS08_RS11640 | - | 75850..76089 (-) | 240 | Protein_75 | hypothetical protein | - |
| CUGBS08_RS00560 (CUGBS08_00114) | - | 76098..76475 (-) | 378 | WP_053515022.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CUGBS08_RS00565 (CUGBS08_00115) | - | 76459..76821 (-) | 363 | WP_061811548.1 | helix-turn-helix domain-containing protein | - |
| CUGBS08_RS00570 (CUGBS08_00116) | - | 77010..77210 (+) | 201 | WP_001875236.1 | helix-turn-helix transcriptional regulator | - |
| CUGBS08_RS00575 (CUGBS08_00117) | - | 77258..77986 (+) | 729 | WP_017647877.1 | phage antirepressor KilAC domain-containing protein | - |
| CUGBS08_RS11310 (CUGBS08_00118) | - | 78019..78177 (+) | 159 | WP_017647876.1 | hypothetical protein | - |
| CUGBS08_RS00580 (CUGBS08_00119) | - | 78174..78467 (-) | 294 | WP_001104373.1 | hypothetical protein | - |
| CUGBS08_RS00585 (CUGBS08_00120) | - | 78596..78853 (+) | 258 | WP_001191791.1 | hypothetical protein | - |
| CUGBS08_RS11315 (CUGBS08_00121) | - | 78883..79026 (+) | 144 | WP_017647875.1 | hypothetical protein | - |
| CUGBS08_RS00590 (CUGBS08_00122) | - | 79055..79813 (+) | 759 | WP_000546751.1 | DnaD domain protein | - |
| CUGBS08_RS00595 (CUGBS08_00123) | - | 79800..80582 (+) | 783 | WP_000600244.1 | ATP-binding protein | - |
| CUGBS08_RS11320 | - | 80573..80716 (+) | 144 | WP_017647874.1 | hypothetical protein | - |
| CUGBS08_RS00600 (CUGBS08_00124) | - | 80709..80984 (+) | 276 | WP_017647873.1 | hypothetical protein | - |
| CUGBS08_RS00605 (CUGBS08_00125) | - | 80971..81225 (+) | 255 | WP_017647872.1 | hypothetical protein | - |
| CUGBS08_RS10625 (CUGBS08_00126) | - | 81228..81389 (+) | 162 | WP_017647871.1 | hypothetical protein | - |
| CUGBS08_RS00610 (CUGBS08_00127) | - | 81390..82343 (+) | 954 | WP_000064172.1 | recombinase RecT | - |
| CUGBS08_RS00615 (CUGBS08_00128) | - | 82340..83137 (+) | 798 | WP_017647870.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| CUGBS08_RS00620 (CUGBS08_00129) | - | 83300..83497 (+) | 198 | WP_017647869.1 | hypothetical protein | - |
| CUGBS08_RS00625 (CUGBS08_00130) | - | 83487..83963 (+) | 477 | WP_017647868.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CUGBS08_RS00630 (CUGBS08_00131) | - | 83953..84300 (+) | 348 | WP_017647944.1 | hypothetical protein | - |
| CUGBS08_RS00635 (CUGBS08_00132) | - | 84312..84608 (+) | 297 | WP_017647866.1 | nucleotide modification associated domain-containing protein | - |
| CUGBS08_RS11325 (CUGBS08_00133) | - | 84592..84750 (+) | 159 | WP_017647865.1 | hypothetical protein | - |
| CUGBS08_RS00640 (CUGBS08_00134) | - | 84747..85130 (+) | 384 | WP_017647864.1 | YopX family protein | - |
| CUGBS08_RS10630 (CUGBS08_00135) | - | 85127..85291 (+) | 165 | WP_017647863.1 | hypothetical protein | - |
| CUGBS08_RS00645 (CUGBS08_00136) | - | 85288..85557 (+) | 270 | WP_017647862.1 | hypothetical protein | - |
| CUGBS08_RS00650 (CUGBS08_00137) | - | 85560..86045 (+) | 486 | WP_017647943.1 | class I SAM-dependent methyltransferase | - |
| CUGBS08_RS00655 (CUGBS08_00138) | - | 86050..86541 (+) | 492 | WP_017285439.1 | hypothetical protein | - |
| CUGBS08_RS00660 (CUGBS08_00139) | - | 86545..87072 (+) | 528 | WP_017647942.1 | DUF1642 domain-containing protein | - |
| CUGBS08_RS00665 (CUGBS08_00140) | - | 87093..87392 (+) | 300 | WP_001105090.1 | hypothetical protein | - |
| CUGBS08_RS00670 (CUGBS08_00141) | - | 87410..87676 (+) | 267 | WP_017647858.1 | hypothetical protein | - |
| CUGBS08_RS00675 (CUGBS08_00142) | - | 88071..88496 (+) | 426 | WP_000533372.1 | DUF1492 domain-containing protein | - |
| CUGBS08_RS00685 (CUGBS08_00144) | - | 89713..90093 (+) | 381 | WP_000090087.1 | hypothetical protein | - |
| CUGBS08_RS00690 (CUGBS08_00145) | - | 90083..91357 (+) | 1275 | WP_000634503.1 | PBSX family phage terminase large subunit | - |
| CUGBS08_RS00695 (CUGBS08_00146) | - | 91357..92682 (+) | 1326 | WP_065367292.1 | phage portal protein | - |
| CUGBS08_RS00700 (CUGBS08_00147) | - | 92651..93577 (+) | 927 | WP_061811549.1 | minor capsid protein | - |
| CUGBS08_RS00705 (CUGBS08_00149) | - | 93711..94037 (+) | 327 | WP_053515038.1 | hypothetical protein | - |
| CUGBS08_RS00710 (CUGBS08_00150) | - | 94151..94720 (+) | 570 | WP_053515039.1 | DUF4355 domain-containing protein | - |
| CUGBS08_RS00715 (CUGBS08_00151) | - | 94739..95629 (+) | 891 | WP_053515040.1 | hypothetical protein | - |
| CUGBS08_RS00720 (CUGBS08_00152) | - | 95642..95935 (+) | 294 | WP_053515041.1 | HeH/LEM domain-containing protein | - |
| CUGBS08_RS00725 (CUGBS08_00153) | - | 95949..96293 (+) | 345 | WP_053515042.1 | hypothetical protein | - |
| CUGBS08_RS00730 (CUGBS08_00154) | - | 96290..96601 (+) | 312 | WP_053515043.1 | hypothetical protein | - |
| CUGBS08_RS00735 (CUGBS08_00155) | - | 96598..96993 (+) | 396 | WP_053515044.1 | hypothetical protein | - |
| CUGBS08_RS00740 (CUGBS08_00156) | - | 96995..97405 (+) | 411 | WP_053515045.1 | DUF5072 family protein | - |
| CUGBS08_RS00745 (CUGBS08_00157) | - | 97417..97923 (+) | 507 | WP_053515046.1 | phage major tail protein, TP901-1 family | - |
| CUGBS08_RS00750 (CUGBS08_00158) | - | 97936..98253 (+) | 318 | WP_053515047.1 | hypothetical protein | - |
| CUGBS08_RS00755 (CUGBS08_00159) | - | 98226..98684 (+) | 459 | WP_053515048.1 | hypothetical protein | - |
| CUGBS08_RS00760 (CUGBS08_00160) | - | 98677..100875 (+) | 2199 | WP_053515049.1 | phage tail protein | - |
| CUGBS08_RS00765 (CUGBS08_00161) | - | 100886..102394 (+) | 1509 | WP_053515074.1 | distal tail protein Dit | - |
| CUGBS08_RS00770 (CUGBS08_00162) | - | 102385..107352 (+) | 4968 | WP_061811550.1 | glucosaminidase domain-containing protein | - |
| CUGBS08_RS00775 (CUGBS08_00163) | - | 107353..109356 (+) | 2004 | WP_061811551.1 | DUF859 family phage minor structural protein | - |
| CUGBS08_RS00780 (CUGBS08_00164) | - | 109368..109760 (+) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| CUGBS08_RS11535 | - | 109783..109911 (+) | 129 | WP_017647842.1 | hypothetical protein | - |
| CUGBS08_RS00785 (CUGBS08_00166) | - | 109920..110222 (+) | 303 | WP_017647841.1 | hypothetical protein | - |
| CUGBS08_RS00790 (CUGBS08_00167) | - | 110215..110442 (+) | 228 | WP_000609111.1 | phage holin | - |
| CUGBS08_RS00795 (CUGBS08_00169) | - | 110568..111902 (+) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| CUGBS08_RS00800 (CUGBS08_00170) | - | 112046..112297 (-) | 252 | WP_000455662.1 | hypothetical protein | - |
| CUGBS08_RS11330 (CUGBS08_00171) | - | 112438..112584 (-) | 147 | WP_001030869.1 | hypothetical protein | - |
| CUGBS08_RS00805 (CUGBS08_00172) | - | 112734..112943 (+) | 210 | WP_000424774.1 | helix-turn-helix domain-containing protein | - |
| CUGBS08_RS00810 (CUGBS08_00173) | prx | 113066..113248 (+) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| CUGBS08_RS00815 (CUGBS08_00174) | - | 113461..114153 (+) | 693 | WP_000049272.1 | histidine phosphatase family protein | - |
| CUGBS08_RS00820 (CUGBS08_00175) | - | 114150..114902 (+) | 753 | WP_000739808.1 | M15 family metallopeptidase | - |
| CUGBS08_RS00825 (CUGBS08_00176) | - | 114899..115474 (+) | 576 | WP_001231504.1 | glycoside hydrolase family 73 protein | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 19447.28 Da Isoelectric Point: 6.2639
>NTDB_id=140427 CUGBS08_RS00545 WP_001204194.1 73474..73953(+) (comX/sigX) [Streptococcus agalactiae strain CU_GBS_08]
MRDFEELFDKVKPIVMKLRRNYFVQLWEYDDWIQEGRIVLFRLLEEHPYLLDNESKLFIYFKTKFSNYLNDVLRHQDCQK
RQFNKMPYEEISEVSHYVKSKGLVLDDYIAYRDTLTKVEETLSDIDKEKFEKLISGERFAGKKQFIRDIQPFFNAFKAD
MRDFEELFDKVKPIVMKLRRNYFVQLWEYDDWIQEGRIVLFRLLEEHPYLLDNESKLFIYFKTKFSNYLNDVLRHQDCQK
RQFNKMPYEEISEVSHYVKSKGLVLDDYIAYRDTLTKVEETLSDIDKEKFEKLISGERFAGKKQFIRDIQPFFNAFKAD
Nucleotide
Download Length: 480 bp
>NTDB_id=140427 CUGBS08_RS00545 WP_001204194.1 73474..73953(+) (comX/sigX) [Streptococcus agalactiae strain CU_GBS_08]
TTGAGAGATTTTGAGGAGTTGTTTGATAAAGTAAAGCCAATCGTAATGAAGCTGAGAAGAAATTATTTTGTTCAACTTTG
GGAATATGATGATTGGATTCAAGAAGGACGTATTGTACTTTTTAGGTTGCTTGAAGAGCATCCGTATTTATTGGATAATG
AAAGCAAACTATTCATTTACTTTAAAACAAAATTTTCAAATTATTTAAACGATGTATTAAGACACCAAGATTGTCAAAAG
CGACAATTTAATAAAATGCCTTATGAAGAAATCAGTGAAGTTAGTCACTATGTTAAGAGTAAAGGACTAGTTTTAGATGA
CTATATTGCTTATCGTGATACTTTAACAAAAGTGGAAGAAACTTTGTCAGATATTGATAAAGAAAAATTTGAAAAACTGA
TTAGTGGTGAACGTTTTGCGGGGAAGAAACAATTCATACGAGATATTCAACCTTTTTTCAATGCTTTTAAAGCGGATTAA
TTGAGAGATTTTGAGGAGTTGTTTGATAAAGTAAAGCCAATCGTAATGAAGCTGAGAAGAAATTATTTTGTTCAACTTTG
GGAATATGATGATTGGATTCAAGAAGGACGTATTGTACTTTTTAGGTTGCTTGAAGAGCATCCGTATTTATTGGATAATG
AAAGCAAACTATTCATTTACTTTAAAACAAAATTTTCAAATTATTTAAACGATGTATTAAGACACCAAGATTGTCAAAAG
CGACAATTTAATAAAATGCCTTATGAAGAAATCAGTGAAGTTAGTCACTATGTTAAGAGTAAAGGACTAGTTTTAGATGA
CTATATTGCTTATCGTGATACTTTAACAAAAGTGGAAGAAACTTTGTCAGATATTGATAAAGAAAAATTTGAAAAACTGA
TTAGTGGTGAACGTTTTGCGGGGAAGAAACAATTCATACGAGATATTCAACCTTTTTTCAATGCTTTTAAAGCGGATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.