Detailed information NTG1155636

Bioinformatically predicted

Overview

• Name: comX/sigX
• Type: Regulator
• Locus tag: QNH80_RS07180
• Genome accession: NZ_OX352996
• Coordinates: 1482759..1483229 (-)
• Length: 156 a.a.
• NCBI ID: WP_011921639.1
• Uniprot ID: A0A123YDQ1
• Organism: Streptococcus suis isolate 861160_dhsdS
• Function: activate transcription of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	1483436..1484299	1482759..1483229	flank	207

Gene organization within MGE regions

Location: 1482759..1484299

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QNH80_RS07180	comX/sigX	1482759..1483229 (-)	471	WP_011921639.1	sigma-70 family RNA polymerase sigma factor	Regulator
QNH80_RS07185	-	1483436..1484299 (-)	864	WP_024405863.1	IS982 family transposase	-

Sequence

Protein

• Length: 156 a.a.
• Molecular weight: 19099.01 Da
• Isoelectric Point: 8.9059

>NTDB_id=1155636 QNH80_RS07180 WP_011921639.1 1482759..1483229(-) (comX/sigX) [Streptococcus suis isolate 861160_dhsdS]
MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLEAQPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKR
KFDRMPHEDIYELSHAIQSPGLINDELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR

Nucleotide

• Length: 471 bp

>NTDB_id=1155636 QNH80_RS07180 WP_011921639.1 1482759..1483229(-) (comX/sigX) [Streptococcus suis isolate 861160_dhsdS]
ATGGAATTCGAAAAAGTGTACGCAAGCGTCAAAGGTATTGTAAACAAGGCTCGAAAAGAGTTTTACATTAAACTATGGGA
TCGAGATGATTGGGAACAAGAAGGAATGATGACCTTGTTTGAATTGTTGGAAGCTCAACCGTGGCTAGTTGATGAACAAG
TTCAATTATATTGTTATTTTAAAGTCAAGTTCAGAAATCGAATCAAAGATCGTATCCGCAAACAGGAAAGTCAAAAACGC
AAGTTTGACCGTATGCCACATGAAGATATTTACGAATTATCTCACGCAATACAATCACCGGGATTGATAAACGATGAATT
ATTAATGTTGAGAGGTGCCTTGAGAGATTATCGAAAAAATCTGAGCAATGATCAACTTGATAAATACGAAAAATTAATTA
GCGGACAATGTTTTAATGGTCGCCGTGAAATGATACGTGATTTACAAATTCATTTGAAAGACTTTCGCTAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A123YDQ1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX/sigX	Streptococcus suis isolate S10	100	100	1
comX/sigX	Streptococcus suis P1/7	100	100	1
comX/sigX	Streptococcus suis D9	99.359	100	0.994
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	49.032	99.359	0.487
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	49.032	99.359	0.487
comX/comX1	Streptococcus pneumoniae TIGR4	46.358	96.795	0.449
comX/comX2	Streptococcus pneumoniae TIGR4	46.358	96.795	0.449
comX/sigX/comX2/sigX2	Streptococcus mitis NCTC 12261	45.752	98.077	0.449
comX/sigX/comX1/sigX1	Streptococcus mitis SK321	45.098	98.077	0.442
comX/sigX/comX2/sigX2	Streptococcus mitis SK321	45.098	98.077	0.442
comX/comX1	Streptococcus pneumoniae Rx1	45.695	96.795	0.442
comX/comX2	Streptococcus pneumoniae D39	45.695	96.795	0.442
comX/comX1	Streptococcus pneumoniae D39	45.695	96.795	0.442
comX/comX2	Streptococcus pneumoniae R6	45.695	96.795	0.442
comX/comX1	Streptococcus pneumoniae R6	45.695	96.795	0.442
comX/comX2	Streptococcus pneumoniae Rx1	45.695	96.795	0.442
comX/sigX/comX1/sigX1	Streptococcus mitis NCTC 12261	44.444	98.077	0.436
comX/sigX	Streptococcus mutans UA159	43.226	99.359	0.429
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	40.645	99.359	0.404
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	40.645	99.359	0.404
comX	Streptococcus sobrinus strain NIDR 6715-7	40.523	98.077	0.397
comX	Streptococcus thermophilus LMG 18311	40.523	98.077	0.397
comX	Streptococcus thermophilus LMD-9	40.523	98.077	0.397
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	40	99.359	0.397
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	40	99.359	0.397
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	40	99.359	0.397
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	40	99.359	0.397
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	38.854	100	0.391
comX	Streptococcus salivarius SK126	39.869	98.077	0.391
comX/sigX	Streptococcus salivarius strain HSISS4	39.869	98.077	0.391