Detailed information NTG1144749

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: LPM7613_RS08920
• Genome accession: NZ_LT598657
• Coordinates: 2019396..2019806 (-)
• Length: 136 a.a.
• NCBI ID: WP_016356941.1
• Uniprot ID: -
• Organism: Legionella pneumophila strain Lpm7613 isolate Lpm7613
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2014396..2024806

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LPM7613_RS08905	letS	2014716..2017448 (+)	2733	WP_010947629.1	two-component system sensor histidine kinase LetS	Regulator
LPM7613_RS08910	-	2017545..2018789 (+)	1245	WP_010947630.1	6-phosphofructokinase	-
LPM7613_RS08915	pilA2	2018786..2019199 (-)	414	WP_015444381.1	pilin	Machinery gene
LPM7613_RS08920	pilA2	2019396..2019806 (-)	411	WP_016356941.1	pilin	Machinery gene
LPM7613_RS08925	-	2020109..2020426 (+)	318	WP_010947633.1	BolA family protein	-
LPM7613_RS08930	-	2020501..2021922 (+)	1422	WP_010947634.1	APC family permease	-
LPM7613_RS08935	-	2022053..2023483 (-)	1431	WP_010947635.1	cellulase family glycosylhydrolase	-
LPM7613_RS08940	kdsB	2023729..2024481 (-)	753	WP_010947636.1	3-deoxy-manno-octulosonate cytidylyltransferase	-
LPM7613_RS08945	-	2024478..2024657 (-)	180	WP_010947637.1	Trm112 family protein	-

Sequence

Protein

• Length: 136 a.a.
• Molecular weight: 13953.16 Da
• Isoelectric Point: 8.4715

>NTDB_id=1144749 LPM7613_RS08920 WP_016356941.1 2019396..2019806(-) (pilA2) [Legionella pneumophila strain Lpm7613 isolate Lpm7613]
MRQKGFTLIELMIVVAIIGILAAIAIPAYQDYTIRARVTEGLTLADSAKLAVSETAITNNALPPTQAATGYVSPAATPNV
QSIAIGANGVITITYTASAGGGTIVMTPTLQANGDVTWTCTGGTLLAKYRPASCRP

Nucleotide

• Length: 411 bp

>NTDB_id=1144749 LPM7613_RS08920 WP_016356941.1 2019396..2019806(-) (pilA2) [Legionella pneumophila strain Lpm7613 isolate Lpm7613]
ATGAGACAAAAGGGTTTTACTTTAATTGAATTGATGATAGTCGTAGCGATTATCGGTATTTTGGCAGCAATCGCTATACC
AGCCTATCAAGATTACACAATACGAGCTCGTGTTACGGAAGGTCTGACCTTGGCAGATTCTGCAAAACTTGCCGTATCTG
AAACGGCTATTACCAACAACGCGTTACCACCTACTCAGGCTGCAACGGGCTACGTGTCTCCCGCAGCTACGCCCAATGTA
CAATCAATTGCTATTGGTGCCAACGGTGTGATTACCATAACATATACCGCTTCAGCAGGTGGTGGTACCATAGTTATGAC
CCCAACCTTACAAGCTAACGGTGATGTAACCTGGACTTGTACGGGTGGTACATTATTGGCCAAATACCGACCTGCCAGTT
GCAGACCATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

• Pilin (bacterial filament) (Pilin) (35-135)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila str. Paris	97.794	100	0.978
pilA2	Legionella pneumophila strain ERS1305867	97.794	100	0.978
pilA	Ralstonia pseudosolanacearum GMI1000	48.447	100	0.574
comP	Acinetobacter baylyi ADP1	53.103	100	0.566
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	36.413	100	0.493
pilA/pilA1	Eikenella corrodens VA1	39.873	100	0.463
pilE	Neisseria gonorrhoeae strain FA1090	38.217	100	0.441
pilA	Haemophilus influenzae 86-028NP	40.816	100	0.441
pilE	Neisseria gonorrhoeae MS11	37.821	100	0.434
pilA/pilAI	Pseudomonas stutzeri DSM 10701	42.963	99.265	0.426
pilA	Pseudomonas aeruginosa PAK	39.189	100	0.426
pilA	Acinetobacter baumannii strain A118	39.041	100	0.419
pilA	Haemophilus influenzae Rd KW20	40.741	99.265	0.404
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.855	100	0.404
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.762	100	0.397
pilA	Vibrio cholerae strain A1552	37.762	100	0.397
pilA	Vibrio cholerae C6706	37.762	100	0.397
pilA	Glaesserella parasuis strain SC1401	38.636	97.059	0.375