Detailed information
Bioinformatically predicted
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | AB1F57_RS00615 | Genome accession | NZ_CP162268 |
| Coordinates | 105546..105842 (+) | Length | 98 a.a. |
| NCBI ID | WP_105137567.1 | Uniprot ID | - |
| Organism | Streptococcus sp. ZY1909104 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 100546..110842
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB1F57_RS00590 (AB1F57_00590) | - | 100822..102078 (-) | 1257 | WP_172022804.1 | ISL3 family transposase | - |
| AB1F57_RS00595 (AB1F57_00595) | comX/sigX | 102597..103067 (+) | 471 | WP_105137563.1 | transcriptional regulator | Regulator |
| AB1F57_RS00600 (AB1F57_00600) | - | 103198..103551 (+) | 354 | WP_170239296.1 | DUF1033 family protein | - |
| AB1F57_RS00605 (AB1F57_00605) | comYA | 103646..104596 (+) | 951 | WP_170239295.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AB1F57_RS00610 (AB1F57_00610) | comYB | 104508..105545 (+) | 1038 | WP_367986322.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| AB1F57_RS00615 (AB1F57_00615) | comYC | 105546..105842 (+) | 297 | WP_105137567.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AB1F57_RS00620 (AB1F57_00620) | comGD/cglD | 105808..106233 (+) | 426 | WP_170239294.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AB1F57_RS00625 (AB1F57_00625) | comYE | 106205..106498 (+) | 294 | WP_367985900.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AB1F57_RS00630 (AB1F57_00630) | comYF | 106485..106919 (+) | 435 | WP_170239292.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| AB1F57_RS00635 (AB1F57_00635) | comGG | 106897..107499 (+) | 603 | WP_167785080.1 | competence type IV pilus minor pilin ComGG | - |
| AB1F57_RS00640 (AB1F57_00640) | comYH | 107550..108503 (+) | 954 | WP_367985901.1 | class I SAM-dependent methyltransferase | Machinery gene |
| AB1F57_RS00645 (AB1F57_00645) | - | 108552..109739 (+) | 1188 | WP_367985902.1 | acetate kinase | - |
| AB1F57_RS00650 (AB1F57_00650) | - | 109994..110545 (+) | 552 | WP_105137573.1 | folate family ECF transporter S component | - |
Sequence
Protein
Download Length: 98 a.a. Molecular weight: 11063.15 Da Isoelectric Point: 10.0310
>NTDB_id=1024677 AB1F57_RS00615 WP_105137567.1 105546..105842(+) (comYC) [Streptococcus sp. ZY1909104]
MKKLLKMKKKGFTLVEMLVVLGIISVLLLLFVPNLSKQKEAVRKKGDQAVVKVVESQMELYELEHDKKATVADLQSAGYI
DKKQAEEYEKAKASNPDK
MKKLLKMKKKGFTLVEMLVVLGIISVLLLLFVPNLSKQKEAVRKKGDQAVVKVVESQMELYELEHDKKATVADLQSAGYI
DKKQAEEYEKAKASNPDK
Nucleotide
Download Length: 297 bp
>NTDB_id=1024677 AB1F57_RS00615 WP_105137567.1 105546..105842(+) (comYC) [Streptococcus sp. ZY1909104]
ATGAAGAAATTACTAAAAATGAAGAAAAAAGGTTTCACTCTGGTGGAAATGTTAGTCGTCCTTGGAATTATTAGTGTGCT
TTTACTCTTGTTTGTGCCAAATTTGAGCAAGCAGAAAGAGGCGGTACGGAAAAAAGGAGATCAGGCAGTTGTCAAAGTAG
TAGAGAGTCAGATGGAGCTCTATGAATTGGAACATGACAAGAAAGCAACAGTAGCCGATTTGCAATCTGCTGGCTACATT
GACAAAAAACAGGCAGAAGAATATGAGAAAGCCAAAGCCTCTAATCCAGATAAATAA
ATGAAGAAATTACTAAAAATGAAGAAAAAAGGTTTCACTCTGGTGGAAATGTTAGTCGTCCTTGGAATTATTAGTGTGCT
TTTACTCTTGTTTGTGCCAAATTTGAGCAAGCAGAAAGAGGCGGTACGGAAAAAAGGAGATCAGGCAGTTGTCAAAGTAG
TAGAGAGTCAGATGGAGCTCTATGAATTGGAACATGACAAGAAAGCAACAGTAGCCGATTTGCAATCTGCTGGCTACATT
GACAAAAAACAGGCAGAAGAATATGAGAAAGCCAAAGCCTCTAATCCAGATAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus suis isolate S10 |
79.348 |
93.878 |
0.745 |
| comGC/cglC | Streptococcus mitis SK321 |
60.606 |
100 |
0.612 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
59.596 |
100 |
0.602 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
65.169 |
90.816 |
0.592 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
63.043 |
93.878 |
0.592 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.043 |
93.878 |
0.592 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.043 |
93.878 |
0.592 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.043 |
93.878 |
0.592 |
| comYC | Streptococcus mutans UA140 |
55.102 |
100 |
0.551 |
| comYC | Streptococcus mutans UA159 |
55.102 |
100 |
0.551 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.427 |
90.816 |
0.531 |
| comGC | Staphylococcus aureus N315 |
45.882 |
86.735 |
0.398 |
| comGC | Staphylococcus aureus MW2 |
45.882 |
86.735 |
0.398 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
49.351 |
78.571 |
0.388 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45 |
81.633 |
0.367 |