Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | virAT/- |
Location | 30375..30924 | Replicon | plasmid pVir |
Accession | NC_017284 | ||
Organism | Campylobacter jejuni subsp. jejuni IA3902 |
Toxin (Protein)
Gene name | virT | Uniprot ID | A0A5T0ZCU7 |
Locus tag | CJSA_RS08780 | Protein ID | WP_014517465.1 |
Coordinates | 30649..30924 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | virA | Uniprot ID | A0A5T1T0M3 |
Locus tag | CJSA_RS08775 | Protein ID | WP_014517464.1 |
Coordinates | 30375..30659 (+) | Length | 95 a.a. |
Genomic Context
Location: 25632..25976 (345 bp)
Type: Others
Protein ID: WP_011117579.1
Type: Others
Protein ID: WP_011117579.1
Location: 25990..26298 (309 bp)
Type: Others
Protein ID: WP_011117580.1
Type: Others
Protein ID: WP_011117580.1
Location: 26308..26529 (222 bp)
Type: Others
Protein ID: WP_011799395.1
Type: Others
Protein ID: WP_011799395.1
Location: 26542..26937 (396 bp)
Type: Others
Protein ID: WP_011117582.1
Type: Others
Protein ID: WP_011117582.1
Location: 27010..27420 (411 bp)
Type: Others
Protein ID: WP_011117583.1
Type: Others
Protein ID: WP_011117583.1
Location: 27417..27848 (432 bp)
Type: Others
Protein ID: WP_002815407.1
Type: Others
Protein ID: WP_002815407.1
Location: 28056..28241 (186 bp)
Type: Others
Protein ID: WP_004306057.1
Type: Others
Protein ID: WP_004306057.1
Location: 28253..28423 (171 bp)
Type: Others
Protein ID: WP_002815835.1
Type: Others
Protein ID: WP_002815835.1
Location: 28855..29220 (366 bp)
Type: Others
Protein ID: WP_011117585.1
Type: Others
Protein ID: WP_011117585.1
Location: 29257..29592 (336 bp)
Type: Others
Protein ID: WP_011117586.1
Type: Others
Protein ID: WP_011117586.1
Location: 29789..30151 (363 bp)
Type: Others
Protein ID: WP_011117587.1
Type: Others
Protein ID: WP_011117587.1
Location: 30375..30659 (285 bp)
Type: Antitoxin
Protein ID: WP_014517464.1
Type: Antitoxin
Protein ID: WP_014517464.1
Location: 30649..30924 (276 bp)
Type: Toxin
Protein ID: WP_014517465.1
Type: Toxin
Protein ID: WP_014517465.1
Location: 31038..31430 (393 bp)
Type: Others
Protein ID: WP_014517466.1
Type: Others
Protein ID: WP_014517466.1
Location: 34006..34311 (306 bp)
Type: Others
Protein ID: WP_014517469.1
Type: Others
Protein ID: WP_014517469.1
Location: 34311..34553 (243 bp)
Type: Others
Protein ID: WP_011117593.1
Type: Others
Protein ID: WP_011117593.1
Location: 31657..33228 (1572 bp)
Type: Others
Protein ID: WP_014517467.1
Type: Others
Protein ID: WP_014517467.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJSA_RS08720 (CJSA_pVir0034) | 25632..25976 | + | 345 | WP_011117579.1 | hypothetical protein | - |
CJSA_RS08725 (CJSA_pVir0035) | 25990..26298 | + | 309 | WP_011117580.1 | hypothetical protein | - |
CJSA_RS08730 (CJSA_pVir0036) | 26308..26529 | + | 222 | WP_011799395.1 | hypothetical protein | - |
CJSA_RS08735 (CJSA_pVir0037) | 26542..26937 | + | 396 | WP_011117582.1 | hypothetical protein | - |
CJSA_RS08740 (CJSA_pVir0038) | 27010..27420 | + | 411 | WP_011117583.1 | hypothetical protein | - |
CJSA_RS08745 (CJSA_pVir0039) | 27417..27848 | + | 432 | WP_002815407.1 | hypothetical protein | - |
CJSA_RS08750 (CJSA_pVir0040) | 28056..28241 | + | 186 | WP_004306057.1 | hypothetical protein | - |
CJSA_RS09185 (CJSA_pVir0041) | 28253..28423 | + | 171 | WP_002815835.1 | hypothetical protein | - |
CJSA_RS08760 (CJSA_pVir0042) | 28855..29220 | + | 366 | WP_011117585.1 | hypothetical protein | - |
CJSA_RS08765 (CJSA_pVir0043) | 29257..29592 | + | 336 | WP_011117586.1 | hypothetical protein | - |
CJSA_RS08770 (CJSA_pVir0044) | 29789..30151 | + | 363 | WP_011117587.1 | hypothetical protein | - |
CJSA_RS08775 (CJSA_pVir0045) | 30375..30659 | + | 285 | WP_014517464.1 | hypothetical protein | Antitoxin |
CJSA_RS08780 (CJSA_pVir0046) | 30649..30924 | + | 276 | WP_014517465.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
CJSA_RS08785 (CJSA_pVir0047) | 31038..31430 | + | 393 | WP_014517466.1 | hypothetical protein | - |
CJSA_RS08790 (CJSA_pVir0048) | 31657..33228 | - | 1572 | WP_014517467.1 | relaxase/mobilization nuclease domain-containing protein | - |
CJSA_RS08795 (CJSA_pVir0050) | 34006..34311 | + | 306 | WP_014517469.1 | hypothetical protein | - |
CJSA_RS08800 (CJSA_pVir0051) | 34311..34553 | + | 243 | WP_011117593.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Non-Mobilizable plasmid | - | virB8 / virB9 / virB10 / virB11 / virD4 / virB4 / Cjp54 | 1..37174 | 37174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10872.64 Da Isoelectric Point: 10.2009
>T6286 WP_014517465.1 NC_017284:30649-30924 [Campylobacter jejuni subsp. jejuni IA3902]
MQNKYSVTFSKRFKKDFKKINNNDKKILKKIVNKLANDEVLEEKYKDHALKGNYIGFRECHIKPDLLLVYRKNNDILELY
LANLGNHNNIF
MQNKYSVTFSKRFKKDFKKINNNDKKILKKIVNKLANDEVLEEKYKDHALKGNYIGFRECHIKPDLLLVYRKNNDILELY
LANLGNHNNIF
Download Length: 276 bp
>T6286 NC_017284:30649-30924 [Campylobacter jejuni subsp. jejuni IA3902]
ATGCAGAATAAATATAGCGTTACTTTTTCTAAAAGGTTTAAAAAAGATTTTAAAAAAATAAATAATAATGATAAAAAAAT
TTTAAAAAAAATAGTCAATAAACTTGCCAATGATGAAGTATTAGAAGAAAAATACAAAGACCACGCACTAAAAGGAAATT
ATATCGGTTTTAGAGAATGCCACATTAAACCTGATTTGTTATTAGTCTATCGCAAAAATAATGATATTTTAGAATTATAT
TTGGCTAATTTAGGAAATCACAATAATATTTTTTAG
ATGCAGAATAAATATAGCGTTACTTTTTCTAAAAGGTTTAAAAAAGATTTTAAAAAAATAAATAATAATGATAAAAAAAT
TTTAAAAAAAATAGTCAATAAACTTGCCAATGATGAAGTATTAGAAGAAAAATACAAAGACCACGCACTAAAAGGAAATT
ATATCGGTTTTAGAGAATGCCACATTAAACCTGATTTGTTATTAGTCTATCGCAAAAATAATGATATTTTAGAATTATAT
TTGGCTAATTTAGGAAATCACAATAATATTTTTTAG
Antitoxin
Download Length: 95 a.a. Molecular weight: 11082.46 Da Isoelectric Point: 8.3991
>AT6286 WP_014517464.1 NC_017284:30375-30659 [Campylobacter jejuni subsp. jejuni IA3902]
MFDYSKYENATEKQLIHALTLAEKRAEKLNSQLKENNELFKFLQKKLKNSFNTKKTKKADQRRPELDEAIEDYKNGNVEH
YANVEEAFKALNAE
MFDYSKYENATEKQLIHALTLAEKRAEKLNSQLKENNELFKFLQKKLKNSFNTKKTKKADQRRPELDEAIEDYKNGNVEH
YANVEEAFKALNAE
Download Length: 285 bp
>AT6286 NC_017284:30375-30659 [Campylobacter jejuni subsp. jejuni IA3902]
ATGTTTGATTATTCTAAATATGAAAATGCTACTGAAAAACAATTAATACACGCTTTGACTTTAGCAGAAAAAAGAGCAGA
GAAACTAAACTCGCAATTAAAAGAGAATAACGAACTTTTTAAATTTTTACAAAAAAAGTTAAAAAATTCTTTTAACACCA
AAAAAACAAAAAAAGCAGATCAAAGAAGACCTGAATTAGATGAAGCGATTGAAGATTATAAAAATGGAAATGTAGAACAT
TATGCCAATGTAGAAGAAGCGTTTAAGGCTTTAAATGCAGAATAA
ATGTTTGATTATTCTAAATATGAAAATGCTACTGAAAAACAATTAATACACGCTTTGACTTTAGCAGAAAAAAGAGCAGA
GAAACTAAACTCGCAATTAAAAGAGAATAACGAACTTTTTAAATTTTTACAAAAAAAGTTAAAAAATTCTTTTAACACCA
AAAAAACAAAAAAAGCAGATCAAAGAAGACCTGAATTAGATGAAGCGATTGAAGATTATAAAAATGGAAATGTAGAACAT
TATGCCAATGTAGAAGAAGCGTTTAAGGCTTTAAATGCAGAATAA
Similar Proteins
Only experimentally validated proteins are listed.
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
T166 | Vibrio cholerae O1 biovar El Tor str. N16961 | 47.778 | 100 | 0.483 |
T6127 | Helicobacter pylori 26695 | 47.727 | 97.778 | 0.467 |
T10095 | Clostridium difficile R20291 | 45.652 | 100 | 0.462 |
T28 | Helicobacter pylori 26695 | 46.988 | 94.318 | 0.443 |
T6256 | Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 | 44.444 | 98.901 | 0.44 |
T10181 | Aggregatibacter actinomycetemcomitans D11S 1 | 41.86 | 97.727 | 0.409 |
T10088 | Helicobacter pylori P12 | 40.659 | 100 | 0.407 |
T10111 | Lacticaseibacillus paracasei strain 4366 DinJ and YafQ genes | 36.082 | 100 | 0.385 |
T10112 | Lacticaseibacillus paracasei strain 2333 DinJ and YafQ genes | 35.052 | 100 | 0.374 |
T10070 | Tetragenococcus halophilus NBRC 12172 | 36.264 | 100 | 0.363 |
Multiple sequence alignment
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
No matching records found |
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T0ZCU7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T1T0M3 |
References
(1) Zhangqi Shen et al. (2016) Identification and functional analysis of two toxin-antitoxin systems in Campylobacter jejuni. Molecular Microbiology 101(6):909-23. [PubMed:27291507]