Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | cjpT-cjrA/- |
Location | 30634..31117 | Replicon | plasmid pVir |
Accession | NC_008770 | ||
Organism | Campylobacter jejuni subsp. jejuni 81-176 |
Toxin (Protein)
Gene name | cjpT | Uniprot ID | Q8GJA8 |
Locus tag | CJJ81176_pVir0047 | Protein ID | WP_011117588.1 |
Coordinates | 30634..31038 (+) | Length | 135 a.a. |
Antitoxin (RNA)
Gene name | cjrA | ||
Locus tag | CJJ81176_pVir0047a | ||
Coordinates | 31040..31117 (-) |
Genomic Context
Location: 25704..26048 (345 bp)
Type: Others
Protein ID: WP_011117579.1
Type: Others
Protein ID: WP_011117579.1
Location: 26062..26370 (309 bp)
Type: Others
Protein ID: WP_011117580.1
Type: Others
Protein ID: WP_011117580.1
Location: 26380..26601 (222 bp)
Type: Others
Protein ID: WP_011799395.1
Type: Others
Protein ID: WP_011799395.1
Location: 27082..27492 (411 bp)
Type: Others
Protein ID: WP_011117583.1
Type: Others
Protein ID: WP_011117583.1
Location: 27489..27920 (432 bp)
Type: Others
Protein ID: WP_002815407.1
Type: Others
Protein ID: WP_002815407.1
Location: 28128..28313 (186 bp)
Type: Others
Protein ID: WP_004306057.1
Type: Others
Protein ID: WP_004306057.1
Location: 28325..28495 (171 bp)
Type: Others
Protein ID: WP_002815835.1
Type: Others
Protein ID: WP_002815835.1
Location: 29105..29470 (366 bp)
Type: Others
Protein ID: WP_011117585.1
Type: Others
Protein ID: WP_011117585.1
Location: 29507..29842 (336 bp)
Type: Others
Protein ID: WP_011117586.1
Type: Others
Protein ID: WP_011117586.1
Location: 30039..30401 (363 bp)
Type: Others
Protein ID: WP_011117587.1
Type: Others
Protein ID: WP_011117587.1
Location: 30634..31038 (405 bp)
Type: Toxin
Protein ID: WP_011117588.1
Type: Toxin
Protein ID: WP_011117588.1
Location: 31284..31676 (393 bp)
Type: Others
Protein ID: WP_011117589.1
Type: Others
Protein ID: WP_011117589.1
Location: 34305..34610 (306 bp)
Type: Others
Protein ID: WP_011799398.1
Type: Others
Protein ID: WP_011799398.1
Location: 34610..34852 (243 bp)
Type: Others
Protein ID: WP_011117593.1
Type: Others
Protein ID: WP_011117593.1
Location: 31040..31117 (78 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 31903..33474 (1572 bp)
Type: Others
Protein ID: WP_011799396.1
Type: Others
Protein ID: WP_011799396.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJJ81176_RS08775 (CJJ81176_pVir0035) | 25704..26048 | + | 345 | WP_011117579.1 | hypothetical protein | - |
CJJ81176_RS08780 (CJJ81176_pVir0036) | 26062..26370 | + | 309 | WP_011117580.1 | hypothetical protein | - |
CJJ81176_RS08785 (CJJ81176_pVir0037) | 26380..26601 | + | 222 | WP_011799395.1 | hypothetical protein | - |
CJJ81176_RS08795 (CJJ81176_pVir0039) | 27082..27492 | + | 411 | WP_011117583.1 | hypothetical protein | - |
CJJ81176_RS08800 (CJJ81176_pVir0040) | 27489..27920 | + | 432 | WP_002815407.1 | hypothetical protein | - |
CJJ81176_RS08805 (CJJ81176_pVir0041) | 28128..28313 | + | 186 | WP_004306057.1 | hypothetical protein | - |
CJJ81176_RS09115 (CJJ81176_pVir0042) | 28325..28495 | + | 171 | WP_002815835.1 | hypothetical protein | - |
CJJ81176_RS08815 (CJJ81176_pVir0044) | 29105..29470 | + | 366 | WP_011117585.1 | hypothetical protein | - |
CJJ81176_RS08820 (CJJ81176_pVir0045) | 29507..29842 | + | 336 | WP_011117586.1 | hypothetical protein | - |
CJJ81176_RS08825 (CJJ81176_pVir0046) | 30039..30401 | + | 363 | WP_011117587.1 | hypothetical protein | - |
CJJ81176_RS08830 (CJJ81176_pVir0047) | 30634..31038 | + | 405 | WP_011117588.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
- | 31040..31117 | - | 78 | - | - | Antitoxin |
CJJ81176_RS08835 (CJJ81176_pVir0048) | 31284..31676 | + | 393 | WP_011117589.1 | hypothetical protein | - |
CJJ81176_RS08840 (CJJ81176_pVir0049) | 31903..33474 | - | 1572 | WP_011799396.1 | relaxase/mobilization nuclease domain-containing protein | - |
CJJ81176_RS08845 (CJJ81176_pVir0051) | 34305..34610 | + | 306 | WP_011799398.1 | hypothetical protein | - |
CJJ81176_RS08850 (CJJ81176_pVir0052) | 34610..34852 | + | 243 | WP_011117593.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Non-Mobilizable plasmid | - | virB8 / virB9 / virB10 / virB11 / virD4 / virB4 / Cjp54 | 1..37473 | 37473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15715.47 Da Isoelectric Point: 10.5279
>T6287 WP_011117588.1 NC_008770:30634-31038 [Campylobacter jejuni subsp. jejuni 81-176]
MQNEDLKFDEWNEVKKHIEKEKNKIVKKQKIYWIKIGKNIGSEIFGKGRVFARPVLVINVFYNGLFLGVPLSSKTKNKSG
KLYYKFTDEKGNSQVALLGQMKIFDNKRKITFESNVKNEDFILIKEKIKKNIID
MQNEDLKFDEWNEVKKHIEKEKNKIVKKQKIYWIKIGKNIGSEIFGKGRVFARPVLVINVFYNGLFLGVPLSSKTKNKSG
KLYYKFTDEKGNSQVALLGQMKIFDNKRKITFESNVKNEDFILIKEKIKKNIID
Download Length: 405 bp
>T6287 NC_008770:30634-31038 [Campylobacter jejuni subsp. jejuni 81-176]
ATGCAAAATGAAGATTTGAAATTTGATGAATGGAATGAAGTTAAAAAACATATTGAAAAAGAAAAAAATAAAATTGTTAA
AAAACAAAAAATATATTGGATTAAAATTGGTAAAAATATAGGGAGTGAGATTTTTGGCAAAGGAAGGGTTTTTGCACGCC
CTGTTTTAGTAATTAATGTATTTTATAATGGTTTGTTTTTAGGAGTTCCTTTAAGTTCAAAAACAAAAAATAAAAGTGGT
AAGCTATATTATAAATTCACAGATGAAAAAGGAAATTCGCAAGTTGCACTTTTGGGGCAAATGAAAATTTTTGATAATAA
GAGAAAAATAACATTTGAAAGCAATGTTAAAAATGAAGATTTTATTTTAATAAAAGAAAAAATAAAAAAGAATATTATAG
ATTAA
ATGCAAAATGAAGATTTGAAATTTGATGAATGGAATGAAGTTAAAAAACATATTGAAAAAGAAAAAAATAAAATTGTTAA
AAAACAAAAAATATATTGGATTAAAATTGGTAAAAATATAGGGAGTGAGATTTTTGGCAAAGGAAGGGTTTTTGCACGCC
CTGTTTTAGTAATTAATGTATTTTATAATGGTTTGTTTTTAGGAGTTCCTTTAAGTTCAAAAACAAAAAATAAAAGTGGT
AAGCTATATTATAAATTCACAGATGAAAAAGGAAATTCGCAAGTTGCACTTTTGGGGCAAATGAAAATTTTTGATAATAA
GAGAAAAATAACATTTGAAAGCAATGTTAAAAATGAAGATTTTATTTTAATAAAAGAAAAAATAAAAAAGAATATTATAG
ATTAA
Antitoxin
Download Length: 78 bp
>AT6287 NC_008770:c31117-31040 [Campylobacter jejuni subsp. jejuni 81-176]
TTGACTTCCTAAATGAAAGTTTAGCGAAGAATTGGCTTATCTTTTAGATAGGTTGCCCCGTCATAGAGCGGGGATAAT
TTGACTTCCTAAATGAAAGTTTAGCGAAGAATTGGCTTATCTTTTAGATAGGTTGCCCCGTCATAGAGCGGGGATAAT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z8TNU2 |
Antitoxin
Download structure file
References
(1) Zhangqi Shen et al. (2016) Identification and functional analysis of two toxin-antitoxin systems in Campylobacter jejuni. Molecular Microbiology 101(6):909-23. [PubMed:27291507]