Detailed information NTG0091221

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: L6411_RS00795
• Genome accession: NZ_AP025333
• Coordinates: 124975..125256 (+)
• Length: 93 a.a.
• NCBI ID: WP_237374201.1
• Uniprot ID: -
• Organism: Streptococcus ruminantium strain GUT-189
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 119975..130256

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L6411_RS00775 (GUT189_01220)	-	121559..121927 (+)	369	WP_155962601.1	DUF1033 family protein	-
L6411_RS00780 (GUT189_01230)	-	121965..122915 (-)	951	WP_155974247.1	S66 family peptidase	-
L6411_RS00785 (GUT189_01240)	comYA	123076..124026 (+)	951	WP_155962599.1	competence type IV pilus ATPase ComGA	Machinery gene
L6411_RS00790 (GUT189_01250)	comYB	123947..124978 (+)	1032	WP_272877484.1	competence type IV pilus assembly protein ComGB	Machinery gene
L6411_RS00795 (GUT189_01260)	comYC	124975..125256 (+)	282	WP_237374201.1	competence type IV pilus major pilin ComGC	Machinery gene
L6411_RS00800 (GUT189_01270)	comGD	125243..125656 (+)	414	WP_237374202.1	competence type IV pilus minor pilin ComGD	-
L6411_RS00805 (GUT189_01280)	comYE	125628..125921 (+)	294	WP_155963927.1	competence type IV pilus minor pilin ComGE	Machinery gene
L6411_RS00810 (GUT189_01290)	comGF/cglF	125908..126342 (+)	435	WP_237374203.1	competence type IV pilus minor pilin ComGF	Machinery gene
L6411_RS00815 (GUT189_01300)	comGG	126320..126733 (+)	414	WP_120171207.1	competence type IV pilus minor pilin ComGG	-
L6411_RS00820 (GUT189_01310)	comYH	126738..127691 (+)	954	WP_237374204.1	class I SAM-dependent methyltransferase	Machinery gene
L6411_RS00825 (GUT189_01320)	-	127741..128928 (+)	1188	WP_024532248.1	acetate kinase	-
L6411_RS00830 (GUT189_01330)	-	129233..129787 (+)	555	WP_024532247.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10758.71 Da
• Isoelectric Point: 9.7540

>NTDB_id=91221 L6411_RS00795 WP_237374201.1 124975..125256(+) (comYC) [Streptococcus ruminantium strain GUT-189]
MKKIIEMKNKAFTLVEMLVVLLIISVLLLLFVPNLSKHREAVQKKGNEAVVKIVESQQELYQLEHGHQPSAEELKNKGYI
TEKQLEQYQNAKK

Nucleotide

• Length: 282 bp

>NTDB_id=91221 L6411_RS00795 WP_237374201.1 124975..125256(+) (comYC) [Streptococcus ruminantium strain GUT-189]
ATGAAAAAAATCATCGAAATGAAGAATAAAGCCTTTACACTGGTAGAGATGTTAGTTGTGCTTTTAATTATCAGTGTTCT
CTTGTTGCTGTTTGTGCCGAATTTGAGTAAGCACAGAGAAGCTGTCCAGAAGAAAGGAAATGAAGCGGTTGTTAAAATTG
TAGAAAGTCAGCAAGAACTCTATCAATTGGAACATGGTCATCAACCTTCAGCAGAAGAGTTAAAAAATAAAGGATACATC
ACGGAAAAACAGCTAGAGCAATATCAGAATGCGAAGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	67.742	100	0.677
comGC/cglC	Streptococcus pneumoniae TIGR4	60.215	100	0.602
comGC/cglC	Streptococcus pneumoniae Rx1	60.215	100	0.602
comGC/cglC	Streptococcus mitis NCTC 12261	60.215	100	0.602
comGC/cglC	Streptococcus pneumoniae D39	60.215	100	0.602
comGC/cglC	Streptococcus pneumoniae R6	60.215	100	0.602
comYC	Streptococcus gordonii str. Challis substr. CH1	58.889	96.774	0.57
comGC/cglC	Streptococcus mitis SK321	65.823	84.946	0.559
comGC	Lactococcus lactis subsp. cremoris KW2	54.444	96.774	0.527
comYC	Streptococcus mutans UA140	53.333	96.774	0.516
comYC	Streptococcus mutans UA159	53.333	96.774	0.516
comGC	Staphylococcus aureus MW2	51.282	83.871	0.43
comGC	Staphylococcus aureus N315	51.282	83.871	0.43
comGC	Latilactobacillus sakei subsp. sakei 23K	48.101	84.946	0.409
comGC	Bacillus subtilis subsp. subtilis str. 168	48	80.645	0.387