Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | P2T63_RS11400 | Genome accession | NZ_CP120352 |
| Coordinates | 611917..612027 (+) | Length | 36 a.a. |
| NCBI ID | WP_420871398.1 | Uniprot ID | - |
| Organism | Ligilactobacillus murinus strain PG1-1-10 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 606917..617027
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2T63_RS02815 (P2T63_02815) | - | 607424..607936 (+) | 513 | WP_004051693.1 | VanZ family protein | - |
| P2T63_RS02820 (P2T63_02820) | - | 608019..608750 (+) | 732 | WP_004051694.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| P2T63_RS02825 (P2T63_02825) | rbsK | 608917..609843 (+) | 927 | WP_004051695.1 | ribokinase | - |
| P2T63_RS02830 (P2T63_02830) | comGA | 609952..610926 (+) | 975 | WP_004051696.1 | competence type IV pilus ATPase ComGA | - |
| P2T63_RS02835 (P2T63_02835) | comGB | 610871..611920 (+) | 1050 | WP_004051697.1 | competence type IV pilus assembly protein ComGB | - |
| P2T63_RS11400 | comGC/cglC | 611917..612027 (+) | 111 | WP_420871398.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| P2T63_RS02840 (P2T63_02840) | - | 612011..612220 (+) | 210 | WP_420871399.1 | hypothetical protein | - |
| P2T63_RS02845 (P2T63_02845) | - | 612223..612657 (+) | 435 | WP_004051709.1 | hypothetical protein | - |
| P2T63_RS02850 (P2T63_02850) | - | 612704..612916 (+) | 213 | WP_153551408.1 | hypothetical protein | - |
| P2T63_RS02855 (P2T63_02855) | - | 612855..613355 (+) | 501 | WP_004051720.1 | ComGF family competence protein | - |
| P2T63_RS02860 (P2T63_02860) | - | 613352..613633 (+) | 282 | WP_004051721.1 | hypothetical protein | - |
| P2T63_RS02865 (P2T63_02865) | - | 613708..614718 (+) | 1011 | WP_004051722.1 | class I SAM-dependent methyltransferase | - |
| P2T63_RS02870 (P2T63_02870) | - | 614873..616246 (+) | 1374 | WP_004051723.1 | amino acid permease | - |
Sequence
Protein
Download Length: 36 a.a. Molecular weight: 4147.34 Da Isoelectric Point: 11.3658
>NTDB_id=805161 P2T63_RS11400 WP_420871398.1 611917..612027(+) (comGC/cglC) [Ligilactobacillus murinus strain PG1-1-10]
MKKTKMKAFTLVEMAIVIFIISLLILIIMPNVAKQR
MKKTKMKAFTLVEMAIVIFIISLLILIIMPNVAKQR
Nucleotide
Download Length: 111 bp
>NTDB_id=805161 P2T63_RS11400 WP_420871398.1 611917..612027(+) (comGC/cglC) [Ligilactobacillus murinus strain PG1-1-10]
ATGAAAAAAACTAAGATGAAAGCGTTTACATTAGTGGAAATGGCAATTGTTATCTTTATCATCAGTTTGTTGATCTTGAT
CATCATGCCTAACGTTGCTAAACAACGTTAG
ATGAAAAAAACTAAGATGAAAGCGTTTACATTAGTGGAAATGGCAATTGTTATCTTTATCATCAGTTTGTTGATCTTGAT
CATCATGCCTAACGTTGCTAAACAACGTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.