NTDB

Overview

Name	comP	Type	Machinery gene
Locus tag	PG878_RS05885	Genome accession	NZ_CP115873
Coordinates	1315711..1316136 (+)	Length	141 a.a.
NCBI ID	WP_209029526.1	Uniprot ID	-
Organism	Xanthomonas hawaiiensis strain A6251
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1310711..1321136

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PG878_RS05860	-	1311498..1311956 (-)	459	WP_311186046.1	chorismate-binding protein	-
PG878_RS05865 (PG878_05855)	-	1312025..1312432 (+)	408	WP_209029522.1	RNA-binding S4 domain-containing protein	-
PG878_RS05870 (PG878_05860)	coaE	1312575..1313198 (-)	624	WP_209029523.1	dephospho-CoA kinase	-
PG878_RS05875 (PG878_05865)	-	1313212..1314075 (-)	864	WP_209029524.1	A24 family peptidase	-
PG878_RS05880 (PG878_05870)	pilC	1314082..1315341 (-)	1260	WP_209029525.1	type II secretion system F family protein	Machinery gene
PG878_RS05885 (PG878_05875)	comP	1315711..1316136 (+)	426	WP_209029526.1	pilin	Machinery gene
PG878_RS05890 (PG878_05880)	pilB	1316339..1318075 (+)	1737	WP_209029527.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PG878_RS05895 (PG878_05885)	pilR	1318322..1319710 (-)	1389	WP_209029528.1	sigma-54 dependent transcriptional regulator	Regulator

Sequence

Protein

Download Length: 141 a.a. Molecular weight: 14481.64 Da Isoelectric Point: 8.0987

                                >NTDB_id=774109 PG878_RS05885 WP_209029526.1 1315711..1316136(+) (comP) [Xanthomonas hawaiiensis strain A6251]

MKKQEGFTLIELMIVVAIIAILAAIALPAYQDYTIRSRVSELAVMASSFKTTVAENIANNGGALSAKNCTGVGTTAATTN

MASITCTDATGVITVTGDATKTKGTILTYTPTVGAADSAVGTTWKCVGSGSQAKYYPAECR

Nucleotide

Download Length: 426 bp

                                >NTDB_id=774109 PG878_RS05885 WP_209029526.1 1315711..1316136(+) (comP) [Xanthomonas hawaiiensis strain A6251]

ATGAAGAAGCAAGAGGGCTTTACCCTGATCGAATTGATGATCGTTGTCGCGATCATCGCTATTCTTGCCGCCATTGCGTT

GCCGGCCTATCAGGATTATACCATTCGGTCCCGTGTCAGCGAACTCGCAGTCATGGCGAGTTCGTTCAAGACGACCGTCG

CTGAAAATATCGCCAACAATGGGGGGGCGCTCTCTGCCAAAAACTGTACTGGGGTTGGTACCACTGCGGCAACCACAAAC

ATGGCCTCTATCACTTGTACAGATGCGACCGGTGTTATCACTGTCACTGGTGATGCAACTAAAACCAAGGGTACCATTTT

GACCTATACCCCTACGGTTGGTGCGGCTGATTCCGCTGTTGGTACGACCTGGAAATGTGTTGGTAGTGGTAGCCAGGCTA

AGTATTACCCTGCCGAATGTCGCTGA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)

Pilin (bacterial filament) (Pilin)

(36-141)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comP	Acinetobacter baylyi ADP1	53.642	100	0.574
pilA2	Legionella pneumophila str. Paris	52.518	98.582	0.518
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	39.459	100	0.518
pilA2	Legionella pneumophila strain ERS1305867	51.799	98.582	0.511
pilA	Ralstonia pseudosolanacearum GMI1000	41.463	100	0.482
pilA	Acinetobacter baumannii strain A118	43.836	100	0.454
pilA	Pseudomonas aeruginosa PAK	39.873	100	0.447
pilA/pilA1	Eikenella corrodens VA1	39.735	100	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	41.259	100	0.418
pilA	Haemophilus influenzae 86-028NP	38.462	100	0.39
pilA/pilAII	Pseudomonas stutzeri DSM 10701	37.5	100	0.383
pilA	Haemophilus influenzae Rd KW20	37.5	100	0.383
pilA	Vibrio parahaemolyticus RIMD 2210633	41.085	91.489	0.376
pilA	Glaesserella parasuis strain SC1401	36.62	100	0.369

Detailed information NTG0774109