NTDB

Detailed information

Bioinformatically predicted

Overview
Genomic Context
Sequence
Domains
Secondary structure
3D structure
Transmembrane helices
Similar proteins

Overview

Name	comEA	Type	Machinery gene
Locus tag	NMD80_RS12950	Genome accession	NZ_CP100817
Coordinates	2685928..2686065 (-)	Length	45 a.a.
NCBI ID	WP_370554298.1	Uniprot ID	-
Organism	Edwardsiella tarda strain GT63
Function	dsDNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2680928..2691065

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NMD80_RS12925 (NMD80_12900)	glnK	2681252..2681590 (-)	339	WP_302528230.1	P-II family nitrogen regulator	-
NMD80_RS12930 (NMD80_12905)	-	2681875..2682336 (-)	462	WP_005296844.1	Lrp/AsnC family transcriptional regulator	-
NMD80_RS12935 (NMD80_12910)	cof	2682520..2683338 (-)	819	WP_370558758.1	HMP-PP phosphatase	-
NMD80_RS12940 (NMD80_12915)	-	2683441..2685153 (+)	1713	WP_370558759.1	SgrR family transcriptional regulator	-
NMD80_RS12945 (NMD80_12920)	queC	2685202..2685891 (+)	690	WP_370558760.1	7-cyano-7-deazaguanine synthase QueC	-
NMD80_RS12950 (NMD80_12925)	comEA	2685928..2686065 (-)	138	WP_370554298.1	ComEA family DNA-binding protein	Machinery gene
NMD80_RS12955 (NMD80_12930)	ppiD	2686411..2688291 (-)	1881	WP_370558761.1	peptidylprolyl isomerase	-
NMD80_RS12960 (NMD80_12935)	hupB	2688574..2688846 (-)	273	WP_005283482.1	nucleoid-associated protein HU-beta	-

Sequence

Protein

Download Length: 45 a.a. Molecular weight: 4975.84 Da Isoelectric Point: 11.0200

                                >NTDB_id=707106 NMD80_RS12950 WP_370554298.1 2685928..2686065(-) (comEA) [Edwardsiella tarda strain GT63]

MGLDKAQAIVDFRQQHGAFASLEQLLQVKGIGRALLEKNRARLAL

Nucleotide

Download Length: 138 bp

                                >NTDB_id=707106 NMD80_RS12950 WP_370554298.1 2685928..2686065(-) (comEA) [Edwardsiella tarda strain GT63]

GTGGGGCTGGATAAGGCGCAGGCGATCGTCGATTTTCGGCAGCAGCACGGCGCTTTCGCCAGTCTTGAGCAACTGTTGCA

AGTGAAGGGAATCGGCCGGGCGCTGTTAGAGAAGAATCGCGCACGCTTGGCGTTATAG

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(4-43)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comEA	Acinetobacter baylyi ADP1	57.778	100	0.578
comE1/comEA	Haemophilus influenzae Rd KW20	58.14	95.556	0.556
comEA	Acinetobacter baumannii D1279779	53.333	100	0.533
comEA	Acinetobacter baumannii strain A118	53.333	100	0.533
comEA/comE1	Glaesserella parasuis strain SC1401	57.5	88.889	0.511
comEA	Vibrio cholerae C6706	51.111	100	0.511
comEA	Vibrio cholerae strain A1552	51.111	100	0.511
comEA	Vibrio parahaemolyticus RIMD 2210633	48.889	100	0.489
comEA	Vibrio campbellii strain DS40M4	46.667	100	0.467
comEA	Legionella pneumophila strain ERS1305867	46.512	95.556	0.444
comEA	Legionella pneumophila str. Paris	46.512	95.556	0.444
comE	Neisseria gonorrhoeae MS11	52.632	84.444	0.444
comE	Neisseria gonorrhoeae MS11	52.632	84.444	0.444
comE	Neisseria gonorrhoeae MS11	52.632	84.444	0.444
comE	Neisseria gonorrhoeae MS11	52.632	84.444	0.444
comEA	Lactococcus lactis subsp. cremoris KW2	42.222	100	0.422
comEA	Thermus thermophilus HB27	47.368	84.444	0.4
comA	Synechocystis sp. PCC 6803	41.86	95.556	0.4
comEA	Staphylococcus aureus N315	37.778	100	0.378
comEA	Staphylococcus aureus MW2	37.778	100	0.378

Detailed information NTG0707106