NTDB

Detailed information

Bioinformatically predicted

Overview
Genomic Context
Sequence
Domains
Secondary structure
3D structure
Transmembrane helices
Similar proteins

Overview

Name	comEA	Type	Machinery gene
Locus tag	NMD91_RS11590	Genome accession	NZ_CP100780
Coordinates	2487817..2487954 (-)	Length	45 a.a.
NCBI ID	WP_370554298.1	Uniprot ID	-
Organism	Edwardsiella tarda strain GT123
Function	dsDNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2482817..2492954

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NMD91_RS11565 (NMD91_11540)	glnK	2483146..2483484 (-)	339	WP_205438539.1	P-II family nitrogen regulator	-
NMD91_RS11570 (NMD91_11545)	-	2483759..2484220 (-)	462	WP_205438540.1	Lrp/AsnC family transcriptional regulator	-
NMD91_RS11575 (NMD91_11550)	cof	2484409..2485227 (-)	819	WP_370549079.1	HMP-PP phosphatase	-
NMD91_RS11580 (NMD91_11555)	-	2485329..2487041 (+)	1713	WP_370549080.1	SgrR family transcriptional regulator	-
NMD91_RS11585 (NMD91_11560)	queC	2487090..2487779 (+)	690	WP_005283491.1	7-cyano-7-deazaguanine synthase QueC	-
NMD91_RS11590 (NMD91_11565)	comEA	2487817..2487954 (-)	138	WP_370554298.1	ComEA family DNA-binding protein	Machinery gene
NMD91_RS11595 (NMD91_11570)	ppiD	2488297..2490177 (-)	1881	WP_370549081.1	peptidylprolyl isomerase	-
NMD91_RS11600 (NMD91_11575)	hupB	2490461..2490733 (-)	273	WP_370549082.1	nucleoid-associated protein HU-beta	-

Sequence

Protein

Download Length: 45 a.a. Molecular weight: 4975.84 Da Isoelectric Point: 11.0200

                                >NTDB_id=706901 NMD91_RS11590 WP_370554298.1 2487817..2487954(-) (comEA) [Edwardsiella tarda strain GT123]

MGLDKAQAIVDFRQQHGAFASLEQLLQVKGIGRALLEKNRARLAL

Nucleotide

Download Length: 138 bp

                                >NTDB_id=706901 NMD91_RS11590 WP_370554298.1 2487817..2487954(-) (comEA) [Edwardsiella tarda strain GT123]

GTGGGACTGGACAAGGCGCAGGCGATCGTCGACTTTCGGCAGCAGCACGGTGCCTTCGCCAGCCTCGAGCAACTGTTGCA

AGTGAAGGGAATCGGACGGGCGCTGTTAGAGAAGAATCGTGCACGCCTAGCGTTATAG

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(4-43)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comEA	Acinetobacter baylyi ADP1	57.778	100	0.578
comE1/comEA	Haemophilus influenzae Rd KW20	58.14	95.556	0.556
comEA	Acinetobacter baumannii D1279779	53.333	100	0.533
comEA	Acinetobacter baumannii strain A118	53.333	100	0.533
comEA/comE1	Glaesserella parasuis strain SC1401	57.5	88.889	0.511
comEA	Vibrio cholerae C6706	51.111	100	0.511
comEA	Vibrio cholerae strain A1552	51.111	100	0.511
comEA	Vibrio parahaemolyticus RIMD 2210633	48.889	100	0.489
comEA	Vibrio campbellii strain DS40M4	46.667	100	0.467
comEA	Legionella pneumophila strain ERS1305867	46.512	95.556	0.444
comEA	Legionella pneumophila str. Paris	46.512	95.556	0.444
comE	Neisseria gonorrhoeae MS11	52.632	84.444	0.444
comE	Neisseria gonorrhoeae MS11	52.632	84.444	0.444
comE	Neisseria gonorrhoeae MS11	52.632	84.444	0.444
comE	Neisseria gonorrhoeae MS11	52.632	84.444	0.444
comEA	Lactococcus lactis subsp. cremoris KW2	42.222	100	0.422
comEA	Thermus thermophilus HB27	47.368	84.444	0.4
comA	Synechocystis sp. PCC 6803	41.86	95.556	0.4
comEA	Staphylococcus aureus N315	37.778	100	0.378
comEA	Staphylococcus aureus MW2	37.778	100	0.378

Detailed information NTG0706901