Detailed information NTG0701170

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: NEE09_RS01220
• Genome accession: NZ_CP099641
• Coordinates: 239434..239757 (+)
• Length: 107 a.a.
• NCBI ID: WP_000738628.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain ATCC 700671
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 234434..244757

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NEE09_RS01195	nagA	234563..235714 (+)	1152	WP_001134457.1	N-acetylglucosamine-6-phosphate deacetylase	-
NEE09_RS01200	-	235877..236935 (+)	1059	WP_000649468.1	zinc-dependent alcohol dehydrogenase family protein	-
NEE09_RS01205	-	237086..237451 (+)	366	WP_000286415.1	DUF1033 family protein	-
NEE09_RS01210	comGA/cglA/cilD	237527..238468 (+)	942	WP_000249536.1	competence type IV pilus ATPase ComGA	Machinery gene
NEE09_RS01215	comGB/cglB	238416..239432 (+)	1017	WP_078130737.1	competence type IV pilus assembly protein ComGB	Machinery gene
NEE09_RS01220	comGC/cglC	239434..239757 (+)	324	WP_000738628.1	comG operon protein ComGC	Machinery gene
NEE09_RS01225	comGD/cglD	239720..240154 (+)	435	WP_033606693.1	competence type IV pilus minor pilin ComGD	Machinery gene
NEE09_RS01230	comGE/cglE	240117..240419 (+)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
NEE09_RS01235	comGF/cglF	240382..240843 (+)	462	WP_000250531.1	competence type IV pilus minor pilin ComGF	Machinery gene
NEE09_RS01240	comGG/cglG	240821..241267 (+)	447	WP_001809944.1	competence type IV pilus minor pilin ComGG	Machinery gene
NEE09_RS01245	-	241370..241962 (+)	593	Protein_226	class I SAM-dependent methyltransferase	-
NEE09_RS01250	comYH	242023..242976 (+)	954	WP_000345126.1	class I SAM-dependent methyltransferase	Machinery gene
NEE09_RS01255	-	243027..244217 (+)	1191	WP_000167765.1	acetate kinase	-
NEE09_RS01260	-	244218..244349 (+)	132	WP_000768904.1	hypothetical protein	-
NEE09_RS01265	rnpA	244366..244737 (+)	372	WP_000739246.1	ribonuclease P protein component	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12232.41 Da
• Isoelectric Point: 9.8887

>NTDB_id=701170 NEE09_RS01220 WP_000738628.1 239434..239757(+) (comGC/cglC) [Streptococcus pneumoniae strain ATCC 700671]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQD
DGRITEEQAKAYKEYHDKQNTSQIVKD

Nucleotide

• Length: 324 bp

>NTDB_id=701170 NEE09_RS01220 WP_000738628.1 239434..239757(+) (comGC/cglC) [Streptococcus pneumoniae strain ATCC 700671]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGAC
GATGGACGCATCACGGAAGAACAGGCTAAAGCCTATAAAGAATACCATGATAAACAAAATACTAGTCAAATCGTTAAAGA
TTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis NCTC 12261	93.458	100	0.935
comGC/cglC	Streptococcus pneumoniae D39	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae R6	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae Rx1	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae TIGR4	93.204	96.262	0.897
comGC/cglC	Streptococcus mitis SK321	88.35	96.262	0.85
comYC	Streptococcus gordonii str. Challis substr. CH1	69.388	91.589	0.636
comYC	Streptococcus mutans UA140	64.211	88.785	0.57
comYC	Streptococcus mutans UA159	64.211	88.785	0.57
comYC	Streptococcus suis isolate S10	69.136	75.701	0.523
comGC	Lactococcus lactis subsp. cremoris KW2	54.639	90.654	0.495
comGC	Staphylococcus aureus MW2	48.837	80.374	0.393
comGC	Staphylococcus aureus N315	48.837	80.374	0.393
comGC	Latilactobacillus sakei subsp. sakei 23K	45.349	80.374	0.364