NTDB

Overview

Name	pilA2	Type	Machinery gene
Locus tag	JN531_RS17370	Genome accession	NZ_CP092104
Coordinates	3367830..3368258 (+)	Length	142 a.a.
NCBI ID	WP_275591464.1	Uniprot ID	-
Organism	Flagellatimonas centrodinii strain R2A-3
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3367059..3378426	3367830..3368258	within	0

Gene organization within MGE regions

Location: 3367059..3378426

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JN531_RS16155 (JN531_016155)	-	3367059..3367640 (+)	582	WP_228349882.1	excalibur calcium-binding domain-containing protein	-
JN531_RS17370	pilA2	3367830..3368258 (+)	429	WP_275591464.1	pilin	Machinery gene
JN531_RS16170 (JN531_016170)	-	3368422..3370275 (+)	1854	WP_228349883.1	hypothetical protein	-
JN531_RS16175 (JN531_016175)	-	3370377..3372281 (+)	1905	WP_228349884.1	hypothetical protein	-
JN531_RS16180 (JN531_016180)	-	3372384..3373367 (-)	984	WP_228349885.1	lysylphosphatidylglycerol synthase domain-containing protein	-
JN531_RS16185 (JN531_016185)	-	3373364..3374599 (-)	1236	WP_228349886.1	polysaccharide pyruvyl transferase family protein	-
JN531_RS16190 (JN531_016190)	-	3374700..3375803 (+)	1104	WP_228349887.1	nitroreductase family protein	-
JN531_RS16195 (JN531_016195)	-	3375800..3376801 (-)	1002	WP_228350006.1	DUF354 domain-containing protein	-
JN531_RS16200 (JN531_016200)	-	3376706..3376915 (+)	210	WP_228350008.1	hypothetical protein	-
JN531_RS16205 (JN531_016205)	-	3376884..3377735 (-)	852	WP_228349888.1	glycosyltransferase family 2 protein	-
JN531_RS16210 (JN531_016210)	-	3377774..3378136 (-)	363	WP_228349889.1	DUF86 domain-containing protein	-
JN531_RS16215 (JN531_016215)	-	3378136..3378426 (-)	291	WP_228349890.1	nucleotidyltransferase domain-containing protein	-

Sequence

Protein

Download Length: 142 a.a. Molecular weight: 14742.72 Da Isoelectric Point: 4.1636

                                >NTDB_id=655890 JN531_RS17370 WP_275591464.1 3367830..3368258(+) (pilA2) [Flagellatimonas centrodinii strain R2A-3]

MIKNTQKGFTLIELMIVVAIIGILAAIAIPAYQDYITRSKVTELVTAASACKSSVSEYAQTLGTLPGTLTEAGCNDNTSQ

YVETFAMNASGAITVTASDAVGGSAIGQDYVLTPTFDASSGTVAWACDDSTIPSKYLPANCR

Nucleotide

Download Length: 429 bp

                                >NTDB_id=655890 JN531_RS17370 WP_275591464.1 3367830..3368258(+) (pilA2) [Flagellatimonas centrodinii strain R2A-3]

ATGATCAAGAACACCCAGAAAGGCTTCACGCTCATCGAACTGATGATCGTCGTGGCCATCATCGGCATCCTCGCCGCCAT

CGCCATCCCGGCCTATCAGGACTACATCACCCGCTCCAAGGTGACGGAACTGGTGACCGCAGCTTCGGCATGTAAGTCGT

CCGTTTCCGAGTACGCACAAACCTTGGGCACACTCCCGGGGACCCTGACGGAAGCTGGCTGCAATGACAATACGAGCCAG

TACGTCGAGACGTTTGCAATGAATGCCAGTGGCGCGATCACGGTCACGGCGAGCGACGCTGTCGGCGGCTCAGCAATTGG

CCAAGATTACGTTCTGACCCCGACCTTCGATGCTTCAAGCGGTACAGTCGCATGGGCCTGCGATGATTCAACGATCCCGT

CCAAGTACCTGCCCGCAAACTGCCGCTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(37-142)

Prokaryotic N-terminal methylation motif (N_methyl)

(4-28)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA2	Legionella pneumophila str. Paris	52.899	97.183	0.514
comP	Acinetobacter baylyi ADP1	47.059	100	0.507
pilA2	Legionella pneumophila strain ERS1305867	52.174	97.183	0.507
pilA	Ralstonia pseudosolanacearum GMI1000	40.828	100	0.486
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	35.106	100	0.465
pilE	Neisseria gonorrhoeae MS11	40.385	100	0.444
pilA	Acinetobacter baumannii strain A118	42.759	100	0.437
pilE	Neisseria gonorrhoeae strain FA1090	39.103	100	0.43
pilA/pilAI	Pseudomonas stutzeri DSM 10701	41.781	100	0.43
pilA/pilA1	Eikenella corrodens VA1	37.888	100	0.43
pilA	Vibrio campbellii strain DS40M4	37.5	100	0.401
pilA	Vibrio cholerae C6706	37.415	100	0.387
pilA	Vibrio cholerae strain A1552	37.415	100	0.387
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.415	100	0.387
pilA/pilAII	Pseudomonas stutzeri DSM 10701	36.986	100	0.38
pilA	Glaesserella parasuis strain SC1401	36.486	100	0.38
pilA	Pseudomonas aeruginosa PAK	35.811	100	0.373

Detailed information NTG0655890