Detailed information NTG0061861

Bioinformatically predicted

Overview

• Name: comR/comR2
• Type: Regulator
• Locus tag: SIR_RS09820
• Genome accession: NC_022246
• Coordinates: 18992..19465 (+)
• Length: 157 a.a.
• NCBI ID: WP_021002266.1
• Uniprot ID: T1ZGJ1
• Organism: Streptococcus intermedius B196
• Function: activate transcription of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	18992..48959	18992..19465	within	0

Gene organization within MGE regions

Location: 18992..48959

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SIR_RS09820 (SIR_0016)	comR/comR2	18992..19465 (+)	474	WP_021002266.1	competence-specific global transcription modulator	Regulator
SIR_RS09930 (SIR_0038)	mreC	26427..27233 (+)	807	WP_021002267.1	rod shape-determining protein MreC	-
SIR_RS09935 (SIR_0039)	mreD	27235..27735 (+)	501	WP_003075140.1	rod shape-determining protein MreD	-
SIR_RS09940 (SIR_0040)	pcsB	27845..29026 (+)	1182	WP_003077627.1	peptidoglycan hydrolase PcsB	-
SIR_RS09945 (SIR_0041)	-	29160..30128 (+)	969	WP_003075138.1	ribose-phosphate diphosphokinase	-
SIR_RS09950 (SIR_0042)	-	30292..31479 (+)	1188	WP_009567704.1	pyridoxal phosphate-dependent aminotransferase	-
SIR_RS09955 (SIR_0043)	recO	31457..32230 (+)	774	WP_009567705.1	DNA repair protein RecO	-
SIR_RS09960 (SIR_0044)	plsX	32227..33225 (+)	999	WP_009567706.1	phosphate acyltransferase PlsX	-
SIR_RS09965 (SIR_0045)	-	33222..33467 (+)	246	WP_003075134.1	acyl carrier protein	-
SIR_RS09970 (SIR_0046)	purC	33612..34319 (+)	708	WP_021002268.1	phosphoribosylaminoimidazolesuccinocarboxamide synthase	-
SIR_RS09975 (SIR_0047)	-	34329..38054 (+)	3726	WP_021002269.1	phosphoribosylformylglycinamidine synthase	-
SIR_RS09980 (SIR_0048)	-	38076..38697 (+)	622	Protein_26	DNA alkylation repair protein	-
SIR_RS09985 (SIR_0049)	purF	38723..40162 (+)	1440	WP_021002271.1	amidophosphoribosyltransferase	-
SIR_RS09990 (SIR_0050)	purM	40411..41433 (+)	1023	WP_112384824.1	phosphoribosylformylglycinamidine cyclo-ligase	-
SIR_RS09995 (SIR_0051)	purN	41433..41987 (+)	555	WP_021002273.1	phosphoribosylglycinamide formyltransferase	-
SIR_RS10000 (SIR_0052)	-	42094..42801 (+)	708	WP_002275346.1	suppressor of fused domain protein	-
SIR_RS10005 (SIR_0053)	purH	42843..44390 (+)	1548	WP_021002274.1	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	-
SIR_RS10010 (SIR_0054)	-	44446..46374 (-)	1929	WP_021002275.1	GBS Bsp-like repeat-containing protein	-
SIR_RS19495 (SIR_0056)	-	46897..47796 (+)	900	WP_021002277.1	beta family protein	-
SIR_RS10020 (SIR_0057)	-	47828..48436 (-)	609	WP_021002278.1	sce7726 family protein	-

Sequence

Protein

• Length: 157 a.a.
• Molecular weight: 19418.41 Da
• Isoelectric Point: 8.6124

>NTDB_id=61861 SIR_RS09820 WP_021002266.1 18992..19465(+) (comR/comR2) [Streptococcus intermedius B196]
MDFKELYEKVRGIVLKCRREYYVHLWELSDWDQEGMMVLYELVSRHPYLVEEEAHLYVYYKTKFRNHIKDILRKQESQKR
KLDRQVYEEVSEIGHKLSLKGLYLDELVILRDQLKSYQKQLSPAKQEQYERLLADERFKGRQAMLRELRTYLKDYEM

Nucleotide

• Length: 474 bp

>NTDB_id=61861 SIR_RS09820 WP_021002266.1 18992..19465(+) (comR/comR2) [Streptococcus intermedius B196]
ATGGATTTCAAGGAGTTATATGAGAAAGTAAGGGGAATTGTGCTGAAGTGTCGGCGGGAATATTATGTCCACCTGTGGGA
GCTAAGCGATTGGGACCAAGAAGGGATGATGGTCTTGTATGAGTTGGTGAGTCGCCACCCCTATTTGGTAGAGGAAGAAG
CCCATCTCTATGTTTACTATAAGACAAAGTTTCGGAATCACATAAAGGATATTCTGCGCAAACAAGAAAGTCAAAAGCGC
AAACTGGATCGCCAAGTGTATGAAGAGGTAAGTGAGATTGGGCACAAGTTAAGTCTGAAAGGTCTGTATCTAGACGAGTT
GGTAATACTCCGCGATCAATTAAAGTCCTATCAAAAGCAACTGAGTCCCGCCAAGCAAGAGCAGTATGAGCGGTTACTGG
CAGATGAAAGGTTCAAAGGCCGCCAAGCGATGCTTCGAGAGTTACGAACCTACTTAAAAGACTATGAGATGTAG

Domains

No domain identified.

3D structure

• AlphaFold DB: T1ZGJ1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	60.645	98.726	0.599
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	60.645	98.726	0.599
comX/sigX/comX2/sigX2	Streptococcus mitis NCTC 12261	56.774	98.726	0.561
comX/sigX/comX1/sigX1	Streptococcus mitis NCTC 12261	55.484	98.726	0.548
comX/comX1	Streptococcus pneumoniae Rx1	54.839	98.726	0.541
comX/comX2	Streptococcus pneumoniae D39	54.839	98.726	0.541
comX/comX1	Streptococcus pneumoniae D39	54.839	98.726	0.541
comX/comX1	Streptococcus pneumoniae R6	54.839	98.726	0.541
comX/comX2	Streptococcus pneumoniae R6	54.839	98.726	0.541
comX/comX2	Streptococcus pneumoniae Rx1	54.839	98.726	0.541
comX/sigX/comX2/sigX2	Streptococcus mitis SK321	54.839	98.726	0.541
comX/comX1	Streptococcus pneumoniae TIGR4	54.194	98.726	0.535
comX/sigX/comX1/sigX1	Streptococcus mitis SK321	54.194	98.726	0.535
comX/comX2	Streptococcus pneumoniae TIGR4	54.194	98.726	0.535
comX/sigX	Streptococcus mutans UA159	50.649	98.089	0.497
comX/sigX	Streptococcus suis D9	49.032	98.726	0.484
comX/sigX	Streptococcus suis isolate S10	49.032	98.726	0.484
comX/sigX	Streptococcus suis P1/7	49.032	98.726	0.484
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	43.226	98.726	0.427
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	43.226	98.726	0.427
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	43.226	98.726	0.427
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	43.226	98.726	0.427
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	43.226	98.726	0.427
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	43.226	98.726	0.427
comX	Streptococcus salivarius SK126	42.857	98.089	0.42
comX	Streptococcus thermophilus LMG 18311	42.208	98.089	0.414
comX	Streptococcus thermophilus LMD-9	42.208	98.089	0.414
comX/sigX	Streptococcus salivarius strain HSISS4	42.208	98.089	0.414
comX/sigX	Streptococcus infantarius subsp. infantarius ATCC BAA-102	39.744	99.363	0.395