Detailed information NTG0571973

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: D16iCDA_RS08150
• Genome accession: NZ_CP076114
• Coordinates: 1750969..1751391 (-)
• Length: 140 a.a.
• NCBI ID: WP_070880642.1
• Uniprot ID: -
• Organism: Phytopseudomonas seleniipraecipitans strain D1-6
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1742800..1750909	1750969..1751391	flank	60

Gene organization within MGE regions

Location: 1742800..1751391

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D16iCDA_RS08115 (D16iCDA_08115)	-	1742800..1743972 (+)	1173	WP_070880647.1	glycosyltransferase family 4 protein	-
D16iCDA_RS08120 (D16iCDA_08120)	-	1743969..1744910 (+)	942	WP_083328608.1	glycosyltransferase	-
D16iCDA_RS08125 (D16iCDA_08125)	-	1744900..1745943 (+)	1044	WP_083328607.1	class I SAM-dependent methyltransferase	-
D16iCDA_RS08130 (D16iCDA_08130)	-	1745948..1746841 (+)	894	WP_164090900.1	glycosyltransferase family 2 protein	-
D16iCDA_RS08135 (D16iCDA_08135)	-	1746825..1748030 (-)	1206	WP_241077611.1	lipopolysaccharide biosynthesis protein	-
D16iCDA_RS08140 (D16iCDA_08140)	-	1748137..1748985 (-)	849	WP_241077610.1	glycosyltransferase family 2 protein	-
D16iCDA_RS08145 (D16iCDA_08145)	-	1748996..1750909 (-)	1914	WP_070880643.1	tetratricopeptide repeat protein	-
D16iCDA_RS08150 (D16iCDA_08150)	pilE	1750969..1751391 (-)	423	WP_070880642.1	pilin	Machinery gene

Sequence

Protein

• Length: 140 a.a.
• Molecular weight: 14395.59 Da
• Isoelectric Point: 9.9836

>NTDB_id=571973 D16iCDA_RS08150 WP_070880642.1 1750969..1751391(-) (pilE) [Phytopseudomonas seleniipraecipitans strain D1-6]
MKAQAQKGFTLIELMIVVAIIGILAAIALPAYQDYTKRSHVSEGLSLAGGAKASVTEFYSSNNRMPASNTSAGLATNTDI
KGNAVTSVTVGTGGVITIAYNTKVDAGKTLVLSPTTGAGAVNWKCKLGTIDAKFVPSNCR

Nucleotide

• Length: 423 bp

>NTDB_id=571973 D16iCDA_RS08150 WP_070880642.1 1750969..1751391(-) (pilE) [Phytopseudomonas seleniipraecipitans strain D1-6]
ATGAAAGCTCAAGCTCAGAAGGGTTTTACCCTGATCGAATTGATGATCGTCGTGGCGATTATCGGTATCCTGGCTGCCAT
CGCGCTGCCTGCCTACCAAGACTATACTAAGCGCTCGCATGTTTCTGAGGGTCTGAGTCTTGCCGGTGGCGCCAAGGCCT
CGGTTACTGAGTTCTACTCGTCCAACAACCGTATGCCTGCTAGCAATACATCGGCTGGGCTGGCCACTAATACGGATATT
AAGGGCAACGCTGTTACTAGCGTTACCGTTGGTACTGGCGGTGTAATCACCATTGCCTATAACACCAAGGTTGATGCCGG
TAAGACGCTGGTTCTGAGTCCGACCACTGGTGCTGGCGCAGTCAACTGGAAGTGCAAACTAGGCACTATTGACGCCAAGT
TTGTACCATCGAACTGCCGTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-29)

• Pilin (bacterial filament) (Pilin) (38-140)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae MS11	48.387	100	0.536
pilA	Ralstonia pseudosolanacearum GMI1000	43.452	100	0.521
pilA2	Legionella pneumophila str. Paris	53.676	97.143	0.521
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	37.5	100	0.514
pilA2	Legionella pneumophila strain ERS1305867	52.941	97.143	0.514
pilE	Neisseria gonorrhoeae strain FA1090	46.753	100	0.514
comP	Acinetobacter baylyi ADP1	46.207	100	0.479
pilA/pilA1	Eikenella corrodens VA1	40.523	100	0.443
pilA/pilAI	Pseudomonas stutzeri DSM 10701	41.958	100	0.429
pilA	Pseudomonas aeruginosa PAK	37.748	100	0.407
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.568	99.286	0.393
pilA	Vibrio parahaemolyticus RIMD 2210633	41.221	93.571	0.386
pilA	Haemophilus influenzae Rd KW20	38.806	95.714	0.371
pilA	Vibrio cholerae C6706	35.616	100	0.371
pilA	Vibrio cholerae strain A1552	35.616	100	0.371
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	35.616	100	0.371
pilA	Haemophilus influenzae 86-028NP	38.06	95.714	0.364