Detailed information NTG0055414

Bioinformatically predicted

Overview

• Name: pilA/pilAI
• Type: Machinery gene
• Locus tag: PSEST_RS15975
• Genome accession: NC_019936
• Coordinates: 3455850..3456266 (+)
• Length: 138 a.a.
• NCBI ID: WP_419184897.1
• Uniprot ID: -
• Organism: Stutzerimonas stutzeri RCH2
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3450781..3458914	3455850..3456266	within	0

Gene organization within MGE regions

Location: 3450781..3458914

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PSEST_RS21875 (Psest_3284)	yacG	3450781..3450975 (-)	195	WP_015278006.1	DNA gyrase inhibitor YacG	-
PSEST_RS15955 (Psest_3285)	coaE	3450972..3451580 (-)	609	WP_015278007.1	dephospho-CoA kinase	-
PSEST_RS15960 (Psest_3286)	pilD	3451723..3452592 (-)	870	WP_015278008.1	prepilin peptidase	Machinery gene
PSEST_RS15965 (Psest_3287)	pilC	3452595..3453812 (-)	1218	WP_015278009.1	type II secretion system F family protein	Machinery gene
PSEST_RS15970 (Psest_3288)	pilB	3453814..3455517 (-)	1704	WP_015278010.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PSEST_RS15975 (Psest_3289)	pilA/pilAI	3455850..3456266 (+)	417	WP_419184897.1	pilin	Machinery gene
PSEST_RS15980 (Psest_3290)	pilA/pilAII	3456335..3456751 (+)	417	WP_015278012.1	pilin	Regulator
PSEST_RS15985 (Psest_3291)	-	3456711..3458168 (+)	1458	WP_015278013.1	O-antigen ligase family protein	-
PSEST_RS15990 (Psest_3292)	tfpZ	3458177..3458914 (+)	738	WP_015278014.1	TfpX/TfpZ family type IV pilin accessory protein	-

Sequence

Protein

• Length: 138 a.a.
• Molecular weight: 14004.00 Da
• Isoelectric Point: 8.0987

>NTDB_id=55414 PSEST_RS15975 WP_419184897.1 3455850..3456266(+) (pilA/pilAI) [Stutzerimonas stutzeri RCH2]
MQKGFTLIELMIVVAIIGILAAIALPAYQDYTVRSNAAAALAEITPGKIGFEQAVNEGKTPSTTAADPGYIGVGATTSYC
GVTVTFTQATGVGSIACATTGGNAGKFNSKTITLNRTAEGAWSCASTLDAKYKPGKCS

Nucleotide

• Length: 417 bp

>NTDB_id=55414 PSEST_RS15975 WP_419184897.1 3455850..3456266(+) (pilA/pilAI) [Stutzerimonas stutzeri RCH2]
ATGCAAAAGGGCTTTACGTTGATCGAACTGATGATCGTGGTTGCGATCATTGGTATTCTGGCCGCCATTGCGCTGCCGGC
GTATCAGGACTACACCGTTCGCTCCAACGCTGCCGCCGCGCTGGCCGAAATCACCCCTGGCAAGATCGGTTTTGAGCAAG
CGGTTAACGAAGGTAAAACCCCGTCGACCACTGCGGCCGATCCGGGCTACATCGGCGTCGGCGCCACGACATCTTATTGT
GGCGTAACCGTCACCTTCACACAGGCAACCGGTGTTGGTTCCATCGCTTGTGCAACTACTGGCGGTAACGCTGGCAAGTT
CAACAGCAAAACAATCACGCTTAACCGTACAGCCGAGGGCGCATGGTCTTGTGCAAGCACCTTGGACGCCAAGTACAAGC
CAGGCAAGTGTTCCTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (33-137)

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA/pilAI	Pseudomonas stutzeri DSM 10701	78.986	100	0.79
pilA/pilAII	Pseudomonas stutzeri DSM 10701	65.185	97.826	0.638
pilA	Pseudomonas aeruginosa PAK	45.27	100	0.486
pilA	Acinetobacter baumannii strain A118	47.482	100	0.478
pilA	Ralstonia pseudosolanacearum GMI1000	40.881	100	0.471
comP	Acinetobacter baylyi ADP1	43.056	100	0.449
pilA2	Legionella pneumophila strain ERS1305867	42.466	100	0.449
pilA2	Legionella pneumophila str. Paris	42.466	100	0.449
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	40.94	100	0.442
pilA	Vibrio cholerae strain A1552	40.94	100	0.442
pilA	Vibrio cholerae C6706	40.94	100	0.442
pilE	Neisseria gonorrhoeae strain FA1090	41.085	93.478	0.384
pilA	Vibrio parahaemolyticus RIMD 2210633	36.691	100	0.37