Detailed information NTG1038261

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: AB9L18_RS04400
• Genome accession: NZ_CP167120
• Coordinates: 965233..965649 (+)
• Length: 138 a.a.
• NCBI ID: WP_375069531.1
• Uniprot ID: -
• Organism: Stenotrophomonas lactitubi strain RW9
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	956646..964883	965233..965649	flank	350

Gene organization within MGE regions

Location: 956646..965649

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB9L18_RS04350 (AB9L18_04350)	-	956646..956888 (+)	243	WP_180165749.1	hypothetical protein	-
AB9L18_RS04355 (AB9L18_04355)	rimK	956983..957861 (+)	879	WP_100553389.1	30S ribosomal protein S6--L-glutamate ligase	-
AB9L18_RS04360 (AB9L18_04360)	-	958115..958591 (+)	477	WP_180165747.1	hypothetical protein	-
AB9L18_RS04365 (AB9L18_04365)	-	958681..959154 (+)	474	WP_180165745.1	hypothetical protein	-
AB9L18_RS04370 (AB9L18_04370)	-	959163..959840 (+)	678	WP_025874286.1	response regulator transcription factor	-
AB9L18_RS04375 (AB9L18_04375)	-	959803..961173 (+)	1371	WP_375069523.1	sensor histidine kinase	-
AB9L18_RS04380 (AB9L18_04380)	-	961690..962076 (+)	387	WP_375069525.1	hypothetical protein	-
AB9L18_RS04385 (AB9L18_04385)	coaE	962129..962740 (-)	612	WP_375069527.1	dephospho-CoA kinase	-
AB9L18_RS04390 (AB9L18_04390)	-	962752..963615 (-)	864	WP_025874291.1	A24 family peptidase	-
AB9L18_RS04395 (AB9L18_04395)	pilC	963624..964883 (-)	1260	WP_375069529.1	type II secretion system F family protein	Machinery gene
AB9L18_RS04400 (AB9L18_04400)	comP	965233..965649 (+)	417	WP_375069531.1	pilin	Machinery gene

Sequence

Protein

• Length: 138 a.a.
• Molecular weight: 14036.27 Da
• Isoelectric Point: 8.4883

>NTDB_id=1038261 AB9L18_RS04400 WP_375069531.1 965233..965649(+) (comP) [Stenotrophomonas lactitubi strain RW9]
MKNQKGFTLIELMIVVAIIAILAAIALPAYQDYTVRSRVSEGAVLASGAKATVGENIANAGGTIDATACNGVAVFTTATK
NTASLACKDGVITVTGTAAAKAVPLTFTPVVADAGITWKCESSADNKYLPAECRKAAK

Nucleotide

• Length: 417 bp

>NTDB_id=1038261 AB9L18_RS04400 WP_375069531.1 965233..965649(+) (comP) [Stenotrophomonas lactitubi strain RW9]
ATGAAGAACCAGAAGGGCTTCACCCTTATCGAACTGATGATCGTTGTCGCGATCATCGCTATCTTGGCTGCCATTGCTCT
GCCGGCATACCAGGACTACACGGTCCGCTCGCGCGTTTCGGAAGGCGCTGTGCTGGCGTCCGGTGCGAAGGCTACGGTCG
GTGAGAACATTGCCAACGCTGGTGGCACGATCGACGCAACTGCCTGCAACGGCGTTGCTGTCTTCACCACCGCCACCAAA
AACACCGCATCGCTGGCCTGTAAGGATGGCGTGATCACCGTCACCGGCACCGCCGCAGCCAAGGCGGTCCCGCTGACTTT
CACCCCGGTCGTTGCCGACGCTGGTATCACGTGGAAGTGCGAATCGTCTGCCGACAACAAGTACCTTCCGGCTGAATGCC
GTAAGGCTGCCAAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

• Pilin (bacterial filament) (Pilin) (35-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Acinetobacter baylyi ADP1	52.74	100	0.558
pilA	Ralstonia pseudosolanacearum GMI1000	46.914	100	0.551
pilA2	Legionella pneumophila str. Paris	52.593	97.826	0.514
pilA2	Legionella pneumophila strain ERS1305867	51.852	97.826	0.507
pilA/pilA1	Eikenella corrodens VA1	41.06	100	0.449
pilA/pilAI	Pseudomonas stutzeri DSM 10701	43.571	100	0.442
pilE	Neisseria gonorrhoeae MS11	37.975	100	0.435
pilA	Pseudomonas aeruginosa PAK	39.474	100	0.435
pilE	Neisseria gonorrhoeae strain FA1090	37.662	100	0.42
pilA	Acinetobacter baumannii strain A118	40.714	100	0.413
pilA	Glaesserella parasuis strain SC1401	39.416	99.275	0.391
pilA/pilAII	Pseudomonas stutzeri DSM 10701	36.957	100	0.37
pilA	Haemophilus influenzae Rd KW20	42.149	87.681	0.37
pilA	Vibrio cholerae C6706	34.459	100	0.37
pilA	Vibrio cholerae strain A1552	34.459	100	0.37
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	34.459	100	0.37