Detailed information NTG1000804

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: ABFU21_RS16465
• Genome accession: NZ_CP155988
• Coordinates: 3766925..3767365 (-)
• Length: 146 a.a.
• NCBI ID: WP_011038214.1
• Uniprot ID: Q8P671
• Organism: Xanthomonas campestris pv. campestris strain LMG 08007
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3761925..3772365

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABFU21_RS16445 (ABFU21_16445)	pilR	3762800..3764194 (+)	1395	WP_043877723.1	sigma-54 dependent transcriptional regulator	Regulator
ABFU21_RS16455 (ABFU21_16455)	pilB	3764613..3766346 (-)	1734	WP_075287148.1	type IV-A pilus assembly ATPase PilB	Machinery gene
ABFU21_RS16460 (ABFU21_16460)	-	3766411..3766812 (-)	402	WP_194734302.1	pilin	-
ABFU21_RS16465 (ABFU21_16465)	pilE	3766925..3767365 (-)	441	WP_011038214.1	pilin	Machinery gene
ABFU21_RS16470 (ABFU21_16470)	pilC	3767692..3768948 (+)	1257	WP_011038215.1	type II secretion system F family protein	Machinery gene
ABFU21_RS16475 (ABFU21_16475)	-	3768955..3769818 (+)	864	WP_011038216.1	A24 family peptidase	-
ABFU21_RS16480 (ABFU21_16480)	coaE	3769832..3770455 (+)	624	WP_011038217.1	dephospho-CoA kinase	-
ABFU21_RS16485 (ABFU21_16485)	-	3770987..3771388 (+)	402	WP_019237348.1	SymE family type I addiction module toxin	-
ABFU21_RS16490 (ABFU21_16490)	-	3771463..3771753 (+)	291	WP_011038219.1	DUF1778 domain-containing protein	-
ABFU21_RS16495 (ABFU21_16495)	-	3771750..3772241 (+)	492	WP_075287147.1	GNAT family N-acetyltransferase	-

Sequence

Protein

• Length: 146 a.a.
• Molecular weight: 14797.93 Da
• Isoelectric Point: 9.0090

>NTDB_id=1000804 ABFU21_RS16465 WP_011038214.1 3766925..3767365(-) (pilE) [Xanthomonas campestris pv. campestris strain LMG 08007]
MKKQNGFTLIELMIVVAIIAILAAIALPAYQDYLARSQVSEGLSLASGAKTAVAETYANTGAFPATNAAAGLEAAANIKG
KYVTSVTVGAGGIITAAFNTANAKLSGKNLVLTPTDNNGSISWGCTNGTTIDQKYLPTSCRTAAAP

Nucleotide

• Length: 441 bp

>NTDB_id=1000804 ABFU21_RS16465 WP_011038214.1 3766925..3767365(-) (pilE) [Xanthomonas campestris pv. campestris strain LMG 08007]
ATGAAAAAGCAAAATGGTTTTACACTGATCGAACTCATGATCGTCGTTGCGATCATCGCTATTCTGGCCGCTATCGCTTT
GCCGGCGTACCAGGATTACCTCGCTCGTTCGCAGGTTTCGGAAGGCTTGTCTTTGGCGTCGGGTGCAAAGACAGCTGTCG
CTGAAACTTATGCTAACACCGGTGCCTTCCCGGCGACCAATGCCGCCGCTGGCCTTGAGGCTGCTGCGAACATCAAGGGT
AAGTACGTTACGTCTGTGACGGTGGGGGCGGGTGGGATCATCACCGCGGCATTCAATACTGCTAATGCAAAGTTGAGTGG
CAAGAATCTGGTCCTGACCCCGACTGACAATAACGGTTCGATCAGCTGGGGGTGCACCAACGGCACCACGATTGATCAGA
AGTATCTGCCGACCTCTTGCCGCACTGCGGCGGCTCCGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

• Pilin (bacterial filament) (Pilin) (35-141)

3D structure

• AlphaFold DB: Q8P671

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae MS11	46.875	100	0.514
pilE	Neisseria gonorrhoeae strain FA1090	46.541	100	0.507
pilA2	Legionella pneumophila str. Paris	52.857	95.89	0.507
pilA2	Legionella pneumophila strain ERS1305867	52.143	95.89	0.5
pilA/pilA1	Eikenella corrodens VA1	46.452	100	0.493
comP	Acinetobacter baylyi ADP1	48	100	0.493
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	37.5	100	0.473
pilA	Ralstonia pseudosolanacearum GMI1000	40.244	100	0.452
pilA	Acinetobacter baumannii strain A118	41.333	100	0.425
pilA	Pseudomonas aeruginosa PAK	40.789	100	0.425
pilA	Vibrio campbellii strain DS40M4	40.268	100	0.411
pilA	Vibrio cholerae C6706	38.411	100	0.397
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	38.411	100	0.397
pilA	Vibrio cholerae strain A1552	38.411	100	0.397
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.288	95.205	0.384
pilA	Vibrio parahaemolyticus RIMD 2210633	42.4	85.616	0.363