Detailed information NTG0099737

Bioinformatically predicted

Overview

• Name: pilV
• Type: Machinery gene
• Locus tag: QMN23_RS10420
• Genome accession: NZ_AP027151
• Coordinates: 2249286..2249501 (+)
• Length: 71 a.a.
• NCBI ID: WP_281999251.1
• Uniprot ID: -
• Organism: Geotalea uraniireducens strain NIT-SL11
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2244286..2254501

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QMN23_RS10405 (GURASL_20550)	-	2244784..2245998 (+)	1215	WP_281999248.1	type II secretion system F family protein	-
QMN23_RS10410 (GURASL_20560)	-	2246004..2247677 (+)	1674	WP_281999249.1	ATP-binding protein	-
QMN23_RS10415 (GURASL_20570)	-	2247679..2249058 (+)	1380	WP_281999250.1	sigma-54 dependent transcriptional regulator	-
QMN23_RS10420 (GURASL_20580)	pilV	2249286..2249501 (+)	216	WP_281999251.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
QMN23_RS10425 (GURASL_20590)	-	2249526..2249903 (+)	378	WP_281999252.1	hypothetical protein	-
QMN23_RS10430	-	2250084..2251643 (+)	1560	WP_281999253.1	tetratricopeptide repeat protein	-
QMN23_RS10435	-	2251674..2252465 (+)	792	WP_281999254.1	ABC transporter permease subunit	-
QMN23_RS10440 (GURASL_20620)	-	2252465..2253319 (+)	855	WP_281999255.1	hypothetical protein	-
QMN23_RS10445 (GURASL_20630)	-	2253333..2254247 (+)	915	WP_281999256.1	ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 71 a.a.
• Molecular weight: 7682.95 Da
• Isoelectric Point: 9.6243

>NTDB_id=99737 QMN23_RS10420 WP_281999251.1 2249286..2249501(+) (pilV) [Geotalea uraniireducens strain NIT-SL11]
MLRKLRNSKGFTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAAGSDLRNLKTALESAFADDQSYPPEG

Nucleotide

• Length: 216 bp

>NTDB_id=99737 QMN23_RS10420 WP_281999251.1 2249286..2249501(+) (pilV) [Geotalea uraniireducens strain NIT-SL11]
ATGTTGCGCAAGCTTAGAAACAGCAAAGGTTTCACCCTCATCGAACTGTTGATCGTCGTGGCGATCATCGGTATCCTGGC
GGCCATCGCTATCCCGCAGTTCTCGGCTTACCGCGTTAAAGCGTATAATAGCGCTGCGGGCAGTGATCTGCGAAATCTGA
AAACTGCGCTTGAGTCTGCTTTCGCTGACGATCAATCTTATCCGCCGGAAGGTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	54.688	90.141	0.493
pilA/pilA1	Eikenella corrodens VA1	48.529	95.775	0.465
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	49.231	91.549	0.451
pilA	Vibrio cholerae strain A1552	49.231	91.549	0.451
pilA	Vibrio cholerae C6706	49.231	91.549	0.451
pilA	Acinetobacter baumannii strain A118	55.357	78.873	0.437
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	55.357	78.873	0.437
pilA	Pseudomonas aeruginosa PAK	53.448	81.69	0.437
pilA	Acinetobacter nosocomialis M2	58.824	71.831	0.423
pilA/pilA4	Thermus thermophilus HB27	47.619	88.732	0.423
pilA/pilAI	Pseudomonas stutzeri DSM 10701	47.619	88.732	0.423
pilA/pilA1	Synechocystis sp. PCC 6803	44.776	94.366	0.423
pilE	Acinetobacter baumannii D1279779	48.333	84.507	0.408
pilA	Ralstonia pseudosolanacearum GMI1000	66.667	59.155	0.394
comP	Acinetobacter baylyi ADP1	57.143	69.014	0.394
comF	Acinetobacter baylyi ADP1	50.909	77.465	0.394
pilA/pilAII	Pseudomonas stutzeri DSM 10701	45	84.507	0.38
pilY2	Acinetobacter baumannii D1279779	42.857	88.732	0.38
pilE	Neisseria gonorrhoeae MS11	43.333	84.507	0.366