Detailed information NTG0993636

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: EQB41_RS02890
• Genome accession: NZ_LR129840
• Coordinates: 518366..518515 (+)
• Length: 49 a.a.
• NCBI ID: WP_001818346.1
• Uniprot ID: Q9FBH1
• Organism: Streptococcus pneumoniae strain 4496 isolate 4496
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Genomic Context

Location: 513366..523515

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EQB41_RS02855	-	514968..515171 (+)	204	WP_001093272.1	bacteriocin class II family protein	-
EQB41_RS02860	-	515489..515692 (+)	204	WP_000411016.1	hypothetical protein	-
EQB41_RS02870	-	516695..517499 (+)	805	WP_127820735.1	IS5 family transposase	-
EQB41_RS02875	blpM	517649..517903 (+)	255	WP_000379879.1	two-peptide bacteriocin subunit BlpM	-
EQB41_RS02880	blpN	517919..518122 (+)	204	WP_001099492.1	two-peptide bacteriocin subunit BlpN	-
EQB41_RS02890	cipB	518366..518515 (+)	150	WP_001818346.1	bacteriocin-like peptide BlpO	Regulator
EQB41_RS02895	-	518619..518738 (+)	120	WP_000346296.1	PncF family bacteriocin immunity protein	-
EQB41_RS02905	-	519524..519907 (+)	384	WP_000877381.1	hypothetical protein	-
EQB41_RS02910	-	519959..520648 (+)	690	WP_000760527.1	CPBP family intramembrane glutamic endopeptidase	-
EQB41_RS02915	blpZ	520690..520938 (+)	249	WP_000276499.1	immunity protein BlpZ	-
EQB41_RS02920	-	520968..521579 (+)	612	WP_000394045.1	CPBP family intramembrane glutamic endopeptidase	-
EQB41_RS02925	ccrZ	521740..522534 (+)	795	WP_000363002.1	cell cycle regulator CcrZ	-
EQB41_RS02930	trmB	522531..523166 (+)	636	WP_001266078.1	tRNA (guanosine(46)-N7)-methyltransferase TrmB	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5134.91 Da
• Isoelectric Point: 3.9133

>NTDB_id=993636 EQB41_RS02890 WP_001818346.1 518366..518515(+) (cipB) [Streptococcus pneumoniae strain 4496 isolate 4496]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=993636 EQB41_RS02890 WP_001818346.1 518366..518515(+) (cipB) [Streptococcus pneumoniae strain 4496 isolate 4496]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

3D structure

• AlphaFold DB: Q9FBH1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51