Detailed information NTG0099079

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: SP4011_RS01265
• Genome accession: NZ_AP026968
• Coordinates: 226010..226333 (+)
• Length: 107 a.a.
• NCBI ID: WP_338619538.1
• Uniprot ID: -
• Organism: Streptococcus parapneumoniae strain SP4011
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 221010..231333

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SP4011_RS01240 (SP4011_02210)	nagA	221137..222288 (+)	1152	WP_001134549.1	N-acetylglucosamine-6-phosphate deacetylase	-
SP4011_RS01245 (SP4011_02220)	-	222451..223509 (+)	1059	WP_084886478.1	zinc-dependent alcohol dehydrogenase family protein	-
SP4011_RS01250 (SP4011_02230)	-	223660..224025 (+)	366	WP_338619535.1	DUF1033 family protein	-
SP4011_RS01255 (SP4011_02240)	comGA/cglA/cilD	224103..225044 (+)	942	WP_338619537.1	competence type IV pilus ATPase ComGA	Machinery gene
SP4011_RS01260 (SP4011_02250)	comGB/cglB	224992..226008 (+)	1017	WP_338620380.1	competence type IV pilus assembly protein ComGB	Machinery gene
SP4011_RS01265 (SP4011_02260)	comGC/cglC	226010..226333 (+)	324	WP_338619538.1	competence type IV pilus major pilin ComGC	Machinery gene
SP4011_RS01270 (SP4011_02270)	comGD/cglD	226296..226730 (+)	435	WP_044012294.1	competence type IV pilus minor pilin ComGD	Machinery gene
SP4011_RS01275 (SP4011_02280)	comGE/cglE	226693..226995 (+)	303	WP_000413380.1	competence type IV pilus minor pilin ComGE	Machinery gene
SP4011_RS01280 (SP4011_02290)	comGF/cglF	226958..227419 (+)	462	WP_000250511.1	competence type IV pilus minor pilin ComGF	Machinery gene
SP4011_RS01285 (SP4011_02300)	comGG/cglG	227397..227810 (+)	414	WP_000265635.1	competence type IV pilus minor pilin ComGG	Machinery gene
SP4011_RS01290 (SP4011_02310)	-	228272..229114 (-)	843	WP_000840058.1	helix-turn-helix domain-containing protein	-
SP4011_RS01295 (SP4011_02320)	-	229311..229787 (-)	477	WP_000777684.1	GNAT family N-acetyltransferase	-
SP4011_RS01300 (SP4011_02330)	-	229900..231102 (-)	1203	WP_000855226.1	ATP-grasp domain-containing protein	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12041.16 Da
• Isoelectric Point: 9.8406

>NTDB_id=99079 SP4011_RS01265 WP_338619538.1 226010..226333(+) (comGC/cglC) [Streptococcus parapneumoniae strain SP4011]
MKKMITYLKTAKVKAFTLVEMLVVLLIISVLLLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQA
NDRITEEQAKAYKEYHAKQNKTQTVAD

Nucleotide

• Length: 324 bp

>NTDB_id=99079 SP4011_RS01265 WP_338619538.1 226010..226333(+) (comGC/cglC) [Streptococcus parapneumoniae strain SP4011]
ATGAAAAAAATGATAACATACTTGAAAACAGCTAAGGTTAAAGCTTTCACTCTGGTAGAGATGTTGGTGGTCTTGCTCAT
CATCAGCGTGCTTCTATTACTCTTTGTACCAAATTTGACCAAGCAAAAAGAGGCTGTCAATGATAAAGGAAAAGCTGCTG
TTGTTAAGGTAGTGGAAAGCCAGGCAGAGCTTTATAGCTTAGAAAAAAATGAAGATGCTAGCCTAAGCAAATTACAAGCA
AATGATCGAATCACAGAAGAGCAAGCTAAAGCTTATAAAGAATATCATGCAAAACAAAATAAGACTCAAACCGTTGCAGA
TTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (12-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis NCTC 12261	92.523	100	0.925
comGC/cglC	Streptococcus pneumoniae Rx1	90	93.458	0.841
comGC/cglC	Streptococcus pneumoniae D39	90	93.458	0.841
comGC/cglC	Streptococcus pneumoniae R6	90	93.458	0.841
comGC/cglC	Streptococcus mitis SK321	90	93.458	0.841
comGC/cglC	Streptococcus pneumoniae TIGR4	89	93.458	0.832
comYC	Streptococcus gordonii str. Challis substr. CH1	69.608	95.327	0.664
comYC	Streptococcus mutans UA140	66.337	94.393	0.626
comYC	Streptococcus mutans UA159	66.337	94.393	0.626
comYC	Streptococcus suis isolate S10	65.217	85.981	0.561
comGC	Lactococcus lactis subsp. cremoris KW2	56.989	86.916	0.495
comGC	Staphylococcus aureus MW2	47.674	80.374	0.383
comGC	Staphylococcus aureus N315	47.674	80.374	0.383