Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | R8522_RS10450 | Genome accession | NZ_AP026916 |
| Coordinates | 2021096..2021422 (-) | Length | 108 a.a. |
| NCBI ID | WP_000738624.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain PZ900700006 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2016096..2026422
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8522_RS10405 (PC0006_20790) | rnpA | 2016120..2016491 (-) | 372 | WP_000739246.1 | ribonuclease P protein component | - |
| R8522_RS10410 | - | 2016508..2016639 (-) | 132 | WP_000768904.1 | hypothetical protein | - |
| R8522_RS10415 (PC0006_20800) | - | 2016640..2017830 (-) | 1191 | WP_000167759.1 | acetate kinase | - |
| R8522_RS10420 (PC0006_20810) | comYH | 2017881..2018834 (-) | 954 | WP_000345123.1 | class I SAM-dependent methyltransferase | Machinery gene |
| R8522_RS10425 (PC0006_20820) | - | 2018895..2019482 (-) | 588 | WP_000679774.1 | class I SAM-dependent methyltransferase | - |
| R8522_RS10430 (PC0006_20830) | comGG/cglG | 2019619..2020032 (-) | 414 | WP_000265630.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| R8522_RS10435 | comGF/cglF | 2020010..2020471 (-) | 462 | WP_000250548.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| R8522_RS10440 (PC0006_20850) | comGE/cglE | 2020434..2020736 (-) | 303 | WP_000413380.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| R8522_RS10445 (PC0006_20860) | comGD/cglD | 2020699..2021103 (-) | 405 | WP_000588007.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| R8522_RS10450 (PC0006_20870) | comGC/cglC | 2021096..2021422 (-) | 327 | WP_000738624.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| R8522_RS10455 (PC0006_20880) | comGB/cglB | 2021424..2022440 (-) | 1017 | WP_078140087.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| R8522_RS10460 (PC0006_20890) | comGA/cglA/cilD | 2022388..2023329 (-) | 942 | WP_000249549.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| R8522_RS10465 (PC0006_20900) | - | 2023405..2023770 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| R8522_RS10470 (PC0006_20910) | - | 2023921..2024979 (-) | 1059 | WP_000649471.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| R8522_RS10475 (PC0006_20920) | nagA | 2025142..2026293 (-) | 1152 | WP_001134454.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12227.44 Da Isoelectric Point: 9.9664
>NTDB_id=97676 R8522_RS10450 WP_000738624.1 2021096..2021422(-) (comGC/cglC) [Streptococcus pneumoniae strain PZ900700006]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLAKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLKE
DGRITEEQAKAYKEYNDKNVGANRKVYD
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLAKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLKE
DGRITEEQAKAYKEYNDKNVGANRKVYD
Nucleotide
Download Length: 327 bp
>NTDB_id=97676 R8522_RS10450 WP_000738624.1 2021096..2021422(-) (comGC/cglC) [Streptococcus pneumoniae strain PZ900700006]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGGCCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGCAAGTTAAAAGAA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACAATGATAAAAATGTAGGAGCAAATCGTAAAGTCTA
TGATTAA
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGGCCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGCAAGTTAAAAGAA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACAATGATAAAAATGTAGGAGCAAATCGTAAAGTCTA
TGATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
94.444 |
100 |
0.944 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
93.519 |
100 |
0.935 |
| comGC/cglC | Streptococcus pneumoniae D39 |
93.519 |
100 |
0.935 |
| comGC/cglC | Streptococcus pneumoniae R6 |
93.519 |
100 |
0.935 |
| comGC/cglC | Streptococcus mitis SK321 |
90.741 |
100 |
0.907 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.857 |
90.741 |
0.843 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
70.833 |
88.889 |
0.63 |
| comYC | Streptococcus mutans UA159 |
61.765 |
94.444 |
0.583 |
| comYC | Streptococcus mutans UA140 |
61.765 |
94.444 |
0.583 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
54.902 |
94.444 |
0.519 |
| comYC | Streptococcus suis isolate S10 |
67.901 |
75 |
0.509 |
| comGC | Staphylococcus aureus MW2 |
50 |
79.63 |
0.398 |
| comGC | Staphylococcus aureus N315 |
50 |
79.63 |
0.398 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.349 |
79.63 |
0.361 |