Detailed information NTG0884209

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: RKE25_RS17930
• Genome accession: NZ_CP134867
• Coordinates: 4059234..4059674 (+)
• Length: 146 a.a.
• NCBI ID: WP_311839449.1
• Uniprot ID: A0AA96EK72
• Organism: Dyella sp. BiH032
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	4058470..4069368	4059234..4059674	within	0

Gene organization within MGE regions

Location: 4058470..4069368

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RKE25_RS17925 (RKE25_17925)	-	4058470..4058913 (+)	444	WP_311839448.1	pilin	-
RKE25_RS17930 (RKE25_17930)	pilE	4059234..4059674 (+)	441	WP_311839449.1	pilin	Machinery gene
RKE25_RS17935 (RKE25_17935)	-	4059740..4061764 (+)	2025	WP_311839450.1	tetratricopeptide repeat protein	-
RKE25_RS17940 (RKE25_17940)	-	4061761..4063722 (+)	1962	WP_311839451.1	hypothetical protein	-
RKE25_RS17945 (RKE25_17945)	-	4063854..4064894 (+)	1041	WP_311839452.1	glycosyltransferase family 4 protein	-
RKE25_RS17950 (RKE25_17950)	-	4064891..4065814 (+)	924	WP_311839453.1	NAD-dependent epimerase/dehydratase family protein	-
RKE25_RS17955 (RKE25_17955)	-	4065790..4066836 (+)	1047	WP_311839454.1	glycosyltransferase	-
RKE25_RS17960 (RKE25_17960)	-	4066868..4067818 (-)	951	WP_311839455.1	glycosyltransferase family 2 protein	-
RKE25_RS17965 (RKE25_17965)	-	4067920..4069368 (-)	1449	WP_311839456.1	oligosaccharide flippase family protein	-

Sequence

Protein

• Length: 146 a.a.
• Molecular weight: 15244.50 Da
• Isoelectric Point: 9.6135

>NTDB_id=884209 RKE25_RS17930 WP_311839449.1 4059234..4059674(+) (pilE) [Dyella sp. BiH032]
MKNVQKGFTLIELMIVVAIIAILAAIAIPAYQDYLIRSQVSEGAVLSDGAKTAMGEYYSNKGDFPSNNTSAGLAKAVSIV
GKYVSQVDVSTTKGQIQATFGPNANSKLNGKVLAFSAITNAGSVSWSCTNAATTVDAKYLPTACRK

Nucleotide

• Length: 441 bp

>NTDB_id=884209 RKE25_RS17930 WP_311839449.1 4059234..4059674(+) (pilE) [Dyella sp. BiH032]
ATGAAGAACGTGCAAAAGGGCTTCACCCTGATCGAACTGATGATCGTCGTGGCGATCATCGCCATCCTCGCCGCCATCGC
CATCCCGGCTTATCAGGATTACCTGATCCGCTCGCAGGTGTCCGAAGGCGCGGTGCTGTCGGATGGCGCCAAGACTGCGA
TGGGCGAGTACTACAGCAACAAGGGCGACTTCCCGTCGAACAACACGTCGGCCGGCCTCGCCAAAGCCGTCAGCATCGTG
GGCAAGTATGTCTCGCAGGTCGACGTCTCGACGACGAAGGGCCAGATCCAGGCCACGTTTGGCCCGAATGCCAACAGCAA
GCTCAATGGCAAGGTCCTCGCCTTCTCCGCCATCACCAACGCCGGCAGTGTCTCCTGGTCCTGCACCAACGCCGCGACCA
CGGTCGACGCCAAGTACCTGCCGACCGCTTGCCGCAAGTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (37-145)

• Prokaryotic N-terminal methylation motif (N_methyl) (3-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae MS11	45.963	100	0.507
pilE	Neisseria gonorrhoeae strain FA1090	46.25	100	0.507
pilA/pilA1	Eikenella corrodens VA1	42.038	100	0.452
pilA	Ralstonia pseudosolanacearum GMI1000	38.922	100	0.445
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	34.043	100	0.438
comP	Acinetobacter baylyi ADP1	39.869	100	0.418
pilA2	Legionella pneumophila str. Paris	42.553	96.575	0.411
pilA2	Legionella pneumophila strain ERS1305867	42.553	96.575	0.411
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.972	98.63	0.404
pilA	Acinetobacter baumannii strain A118	39.437	97.26	0.384
pilA	Vibrio cholerae C6706	36.601	100	0.384
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	36.601	100	0.384
pilA	Vibrio cholerae strain A1552	36.601	100	0.384
pilA	Vibrio campbellii strain DS40M4	33.758	100	0.363
pilA	Vibrio parahaemolyticus RIMD 2210633	39.259	92.466	0.363
pilA	Pseudomonas aeruginosa PAK	34.868	100	0.363