Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NQZ94_RS02370 | Genome accession | NZ_CP102140 |
| Coordinates | 445609..446007 (+) | Length | 132 a.a. |
| NCBI ID | WP_022540565.1 | Uniprot ID | A0A0K2E4A3 |
| Organism | Streptococcus suis strain DNC49 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 437172..460193 | 445609..446007 | within | 0 |
Gene organization within MGE regions
Location: 437172..460193
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ94_RS02285 (NQZ94_02285) | - | 437172..438329 (-) | 1158 | WP_024409220.1 | site-specific integrase | - |
| NQZ94_RS02290 (NQZ94_02290) | - | 438526..439257 (-) | 732 | WP_013730164.1 | hypothetical protein | - |
| NQZ94_RS02295 (NQZ94_02295) | - | 439305..439688 (-) | 384 | WP_013730165.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NQZ94_RS02300 (NQZ94_02300) | - | 439695..440243 (-) | 549 | WP_226960627.1 | helix-turn-helix domain-containing protein | - |
| NQZ94_RS02305 (NQZ94_02305) | - | 440260..440460 (+) | 201 | WP_002937001.1 | helix-turn-helix domain-containing protein | - |
| NQZ94_RS02310 (NQZ94_02310) | - | 440530..440856 (+) | 327 | WP_013730166.1 | hypothetical protein | - |
| NQZ94_RS02315 (NQZ94_02315) | - | 440930..441184 (+) | 255 | WP_013730167.1 | hypothetical protein | - |
| NQZ94_RS02320 (NQZ94_02320) | - | 441240..441473 (+) | 234 | WP_226960628.1 | hypothetical protein | - |
| NQZ94_RS02325 (NQZ94_02325) | - | 441463..441615 (+) | 153 | WP_022540561.1 | hypothetical protein | - |
| NQZ94_RS02330 (NQZ94_02330) | - | 441620..441961 (+) | 342 | WP_013730169.1 | hypothetical protein | - |
| NQZ94_RS02335 (NQZ94_02335) | - | 441961..442440 (+) | 480 | WP_013730170.1 | siphovirus Gp157 family protein | - |
| NQZ94_RS02340 (NQZ94_02340) | - | 442437..442682 (+) | 246 | WP_013730171.1 | hypothetical protein | - |
| NQZ94_RS02345 (NQZ94_02345) | - | 442663..443127 (+) | 465 | WP_013730172.1 | hypothetical protein | - |
| NQZ94_RS02350 (NQZ94_02350) | - | 443096..444268 (+) | 1173 | WP_013730173.1 | DEAD/DEAH box helicase family protein | - |
| NQZ94_RS02355 (NQZ94_02355) | - | 444342..444608 (+) | 267 | WP_226960629.1 | hypothetical protein | - |
| NQZ94_RS02360 (NQZ94_02360) | - | 444618..445316 (+) | 699 | WP_013730175.1 | ERF family protein | - |
| NQZ94_RS02365 (NQZ94_02365) | - | 445316..445612 (+) | 297 | WP_022540564.1 | hypothetical protein | - |
| NQZ94_RS02370 (NQZ94_02370) | ssbA | 445609..446007 (+) | 399 | WP_022540565.1 | single-stranded DNA-binding protein | Machinery gene |
| NQZ94_RS02375 (NQZ94_02375) | - | 446018..446845 (+) | 828 | WP_013730177.1 | bifunctional DNA primase/polymerase | - |
| NQZ94_RS02380 (NQZ94_02380) | - | 446829..448208 (+) | 1380 | WP_079253058.1 | virulence-associated E family protein | - |
| NQZ94_RS02385 (NQZ94_02385) | - | 448565..448720 (+) | 156 | WP_013730179.1 | hypothetical protein | - |
| NQZ94_RS02390 (NQZ94_02390) | - | 448717..449025 (+) | 309 | WP_013730180.1 | DUF1372 family protein | - |
| NQZ94_RS02395 (NQZ94_02395) | - | 449027..449242 (+) | 216 | WP_013730181.1 | hypothetical protein | - |
| NQZ94_RS02400 (NQZ94_02400) | - | 449431..449745 (+) | 315 | WP_013730182.1 | hypothetical protein | - |
| NQZ94_RS02405 (NQZ94_02405) | - | 449818..450252 (+) | 435 | WP_002937915.1 | DUF1492 domain-containing protein | - |
| NQZ94_RS02410 (NQZ94_02410) | - | 450349..450696 (+) | 348 | WP_013730183.1 | HNH endonuclease | - |
| NQZ94_RS02415 (NQZ94_02415) | - | 450785..451147 (+) | 363 | WP_105203945.1 | hypothetical protein | - |
| NQZ94_RS02420 (NQZ94_02420) | - | 451144..452409 (+) | 1266 | WP_013730185.1 | phage portal protein | - |
| NQZ94_RS02425 (NQZ94_02425) | - | 452402..453622 (+) | 1221 | WP_013730186.1 | hypothetical protein | - |
| NQZ94_RS02430 (NQZ94_02430) | - | 453627..453860 (+) | 234 | WP_022540567.1 | hypothetical protein | - |
| NQZ94_RS02435 (NQZ94_02435) | - | 454062..455264 (-) | 1203 | WP_079398882.1 | IS110 family transposase | - |
| NQZ94_RS02440 (NQZ94_02440) | - | 455604..455859 (-) | 256 | Protein_441 | IS110 family transposase | - |
| NQZ94_RS02445 (NQZ94_02445) | - | 456168..456455 (+) | 288 | Protein_442 | ISL3 family transposase | - |
| NQZ94_RS02450 (NQZ94_02450) | - | 456979..457617 (-) | 639 | WP_009909540.1 | MBL fold metallo-hydrolase | - |
| NQZ94_RS02455 (NQZ94_02455) | - | 457725..460193 (+) | 2469 | WP_009909541.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 14872.45 Da Isoelectric Point: 4.6583
>NTDB_id=714782 NQZ94_RS02370 WP_022540565.1 445609..446007(+) (ssbA) [Streptococcus suis strain DNC49]
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFINVVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFINVVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
Nucleotide
Download Length: 399 bp
>NTDB_id=714782 NQZ94_RS02370 WP_022540565.1 445609..446007(+) (ssbA) [Streptococcus suis strain DNC49]
ATGATTAACAATGTAGTACTAGTGGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCTTGGCTGTCAATCGAAACTTCAAAAATCAAGATGGGGAGCGTGAAGCGGACTTTATCAACGTAGTCATTT
GGCGTCAACAAGCTGAGAATTTGGCGAATTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACAGGTCGCATTCAGACTCGT
AGCTATGACAATCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGTCCTATGGATATCCAAGACGAAGATTTGCCGTTCTAG
ATGATTAACAATGTAGTACTAGTGGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCTTGGCTGTCAATCGAAACTTCAAAAATCAAGATGGGGAGCGTGAAGCGGACTTTATCAACGTAGTCATTT
GGCGTCAACAAGCTGAGAATTTGGCGAATTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACAGGTCGCATTCAGACTCGT
AGCTATGACAATCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGTCCTATGGATATCCAAGACGAAGATTTGCCGTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.674 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.242 |
100 |
0.492 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.455 |
100 |
0.455 |
| ssbA | Streptococcus mutans UA159 |
44.697 |
100 |
0.447 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.128 |
82.576 |
0.447 |
| ssb | Vibrio cholerae strain A1552 |
29.48 |
100 |
0.386 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
48.113 |
80.303 |
0.386 |