NTDB

Overview

Name	pilE	Type	Machinery gene
Locus tag	XCCCN13v2_RS05415	Genome accession	NZ_CP101178
Coordinates	1277926..1278366 (+)	Length	146 a.a.
NCBI ID	WP_011038214.1	Uniprot ID	Q8P671
Organism	Xanthomonas campestris pv. campestris strain CN13
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1272926..1283366

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
XCCCN13v2_RS05385	-	1273050..1273541 (-)	492	WP_011038220.1	GNAT family N-acetyltransferase	-
XCCCN13v2_RS05390	-	1273538..1273828 (-)	291	WP_011038219.1	DUF1778 domain-containing protein	-
XCCCN13v2_RS05395	-	1273903..1274304 (-)	402	WP_019237348.1	SymE family type I addiction module toxin	-
XCCCN13v2_RS05400	coaE	1274836..1275459 (-)	624	WP_011038217.1	dephospho-CoA kinase	-
XCCCN13v2_RS05405	-	1275473..1276336 (-)	864	WP_011038216.1	A24 family peptidase	-
XCCCN13v2_RS05410	pilC	1276343..1277599 (-)	1257	WP_011038215.1	type II secretion system F family protein	Machinery gene
XCCCN13v2_RS05415	pilE	1277926..1278366 (+)	441	WP_011038214.1	pilin	Machinery gene
XCCCN13v2_RS05420	-	1278446..1278880 (+)	435	WP_011038213.1	pilin	-
XCCCN13v2_RS05425	pilB	1278945..1280678 (+)	1734	WP_011038212.1	type IV-A pilus assembly ATPase PilB	Machinery gene
XCCCN13v2_RS05435	pilR	1281097..1282491 (-)	1395	WP_043877723.1	sigma-54 dependent transcriptional regulator	Regulator

Sequence

Protein

Download Length: 146 a.a. Molecular weight: 14797.93 Da Isoelectric Point: 9.0090

                                >NTDB_id=709162 XCCCN13v2_RS05415 WP_011038214.1 1277926..1278366(+) (pilE) [Xanthomonas campestris pv. campestris strain CN13]

MKKQNGFTLIELMIVVAIIAILAAIALPAYQDYLARSQVSEGLSLASGAKTAVAETYANTGAFPATNAAAGLEAAANIKG

KYVTSVTVGAGGIITAAFNTANAKLSGKNLVLTPTDNNGSISWGCTNGTTIDQKYLPTSCRTAAAP

Nucleotide

Download Length: 441 bp

                                >NTDB_id=709162 XCCCN13v2_RS05415 WP_011038214.1 1277926..1278366(+) (pilE) [Xanthomonas campestris pv. campestris strain CN13]

ATGAAAAAGCAAAATGGTTTTACACTGATCGAACTCATGATCGTCGTTGCGATCATCGCTATTCTGGCCGCTATCGCTTT

GCCGGCGTACCAGGATTACCTCGCTCGTTCGCAGGTTTCGGAAGGCTTGTCTTTGGCGTCGGGTGCAAAGACAGCTGTCG

CTGAAACTTATGCTAACACCGGTGCCTTCCCGGCGACCAATGCCGCCGCTGGCCTTGAGGCTGCTGCGAACATCAAGGGT

AAGTACGTTACGTCTGTGACGGTGGGGGCGGGTGGGATCATCACCGCGGCATTCAATACTGCTAATGCAAAGTTGAGTGG

CAAGAATCTGGTCCTGACCCCGACTGACAATAACGGTTCGATCAGCTGGGGGTGCACCAACGGCACCACGATTGATCAGA

AGTATCTGCCGACCTCTTGCCGCACTGCGGCGGCTCCGTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)

Pilin (bacterial filament) (Pilin)

(35-141)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q8P671

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilE	Neisseria gonorrhoeae MS11	46.875	100	0.514
pilE	Neisseria gonorrhoeae strain FA1090	46.541	100	0.507
pilA2	Legionella pneumophila str. Paris	52.857	95.89	0.507
pilA2	Legionella pneumophila strain ERS1305867	52.143	95.89	0.5
pilA/pilA1	Eikenella corrodens VA1	46.452	100	0.493
comP	Acinetobacter baylyi ADP1	48	100	0.493
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	37.5	100	0.473
pilA	Ralstonia pseudosolanacearum GMI1000	40.244	100	0.452
pilA	Acinetobacter baumannii strain A118	41.333	100	0.425
pilA	Pseudomonas aeruginosa PAK	40.789	100	0.425
pilA	Vibrio campbellii strain DS40M4	40.268	100	0.411
pilA	Vibrio cholerae C6706	38.411	100	0.397
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	38.411	100	0.397
pilA	Vibrio cholerae strain A1552	38.411	100	0.397
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.288	95.205	0.384
pilA	Vibrio parahaemolyticus RIMD 2210633	42.4	85.616	0.363

Detailed information NTG0709162