NTDB

Overview

Name	pilA2	Type	Machinery gene
Locus tag	MUU75_RS15770	Genome accession	NZ_CP095186
Coordinates	3378270..3378683 (-)	Length	137 a.a.
NCBI ID	WP_280640360.1	Uniprot ID	-
Organism	Pseudoxanthomonas mexicana strain F31
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3373270..3383683

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUU75_RS15745 (MUU75_15745)	-	3373312..3374181 (-)	870	WP_245092029.1	FkbM family methyltransferase	-
MUU75_RS15750 (MUU75_15750)	-	3374178..3374963 (-)	786	WP_245092031.1	class I SAM-dependent methyltransferase	-
MUU75_RS15755 (MUU75_15755)	-	3375482..3376159 (+)	678	WP_245106475.1	glycosyltransferase	-
MUU75_RS15760 (MUU75_15760)	-	3376216..3377994 (-)	1779	WP_245106477.1	hypothetical protein	-
MUU75_RS15765 (MUU75_15765)	-	3377976..3378239 (-)	264	WP_245106479.1	DUF4559 domain-containing protein	-
MUU75_RS15770 (MUU75_15770)	pilA2	3378270..3378683 (-)	414	WP_280640360.1	pilin	Machinery gene
MUU75_RS15775 (MUU75_15775)	pilR	3379141..3380541 (-)	1401	WP_245092037.1	sigma-54 dependent transcriptional regulator	Regulator
MUU75_RS15780 (MUU75_15780)	-	3380773..3382392 (-)	1620	WP_245092039.1	ATP-binding protein	-

Sequence

Protein

Download Length: 137 a.a. Molecular weight: 14325.49 Da Isoelectric Point: 4.9006

                                >NTDB_id=676020 MUU75_RS15770 WP_280640360.1 3378270..3378683(-) (pilA2) [Pseudoxanthomonas mexicana strain F31]

MKKNMQGFTLIELMIVIAILGILLAIAIPAYQDYTVRAKVSEGLNLAASPKLAVAEYAISNNAWPTEAQSGYTFAATSIV

NDISIGANGQIVITYQTAEVPGGGTINLTPDTTVAGVTWVCAAGSLPTKYTPSSCRN

Nucleotide

Download Length: 414 bp

                                >NTDB_id=676020 MUU75_RS15770 WP_280640360.1 3378270..3378683(-) (pilA2) [Pseudoxanthomonas mexicana strain F31]

ATGAAGAAGAACATGCAGGGCTTCACCCTGATCGAACTGATGATCGTCATCGCCATCCTGGGCATCCTGCTGGCCATCGC

GATTCCGGCCTATCAGGATTACACCGTCCGCGCCAAGGTCTCGGAAGGTCTGAACCTGGCAGCCTCGCCGAAGCTGGCCG

TCGCCGAGTACGCGATTTCCAACAACGCGTGGCCGACCGAAGCTCAGTCGGGCTACACCTTCGCCGCCACCTCGATCGTC

AACGACATTTCGATCGGCGCCAATGGCCAGATCGTCATCACCTATCAAACTGCGGAAGTCCCGGGCGGCGGCACCATCAA

CCTGACGCCGGACACCACCGTGGCTGGCGTGACCTGGGTCTGCGCGGCTGGCAGCCTGCCGACCAAGTACACCCCGTCCA

GCTGCCGCAACTAA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-27)

Pilin (bacterial filament) (Pilin)

(36-136)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA2	Legionella pneumophila str. Paris	62.5	99.27	0.62
pilA2	Legionella pneumophila strain ERS1305867	62.5	99.27	0.62
pilA	Ralstonia pseudosolanacearum GMI1000	43.976	100	0.533
comP	Acinetobacter baylyi ADP1	47.917	100	0.504
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	35.052	100	0.496
pilE	Neisseria gonorrhoeae strain FA1090	37.975	100	0.438
pilE	Neisseria gonorrhoeae MS11	37.58	100	0.431
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40.426	100	0.416
pilA/pilA1	Eikenella corrodens VA1	35.897	100	0.409
pilA/pilAII	Pseudomonas stutzeri DSM 10701	38.732	100	0.401
pilA	Acinetobacter baumannii strain A118	37.681	100	0.38
pilA	Haemophilus influenzae Rd KW20	42.276	89.781	0.38
pilA	Vibrio parahaemolyticus RIMD 2210633	38.346	97.08	0.372
pilA	Vibrio cholerae C6706	34.483	100	0.365
pilA	Vibrio cholerae strain A1552	34.483	100	0.365
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	34.483	100	0.365

Detailed information NTG0676020