NTDB

Overview

Name	pilA/pilAI	Type	Machinery gene
Locus tag	LZE81_RS14970	Genome accession	NZ_CP090000
Coordinates	3461378..3461809 (-)	Length	143 a.a.
NCBI ID	WP_060744724.1	Uniprot ID	A0A120EV69
Organism	Xanthomonas translucens strain B1FA
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3456378..3466809

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LZE81_RS14945 (LZE81_14945)	pilR	3456513..3457901 (+)	1389	WP_060744723.1	sigma-54 dependent transcriptional regulator	Regulator
LZE81_RS14950 (LZE81_14950)	-	3458090..3458272 (+)	183	WP_003477093.1	YhfG family protein	-
LZE81_RS14955 (LZE81_14955)	-	3458269..3458886 (+)	618	WP_003477095.1	Fic family protein	-
LZE81_RS14960 (LZE81_14960)	pilB	3458896..3460632 (-)	1737	WP_058363696.1	type IV-A pilus assembly ATPase PilB	Machinery gene
LZE81_RS14965 (LZE81_14965)	-	3460895..3461293 (+)	399	WP_196484464.1	hypothetical protein	-
LZE81_RS14970 (LZE81_14970)	pilA/pilAI	3461378..3461809 (-)	432	WP_060744724.1	pilin	Machinery gene
LZE81_RS14975 (LZE81_14975)	pilC	3462194..3463453 (+)	1260	WP_060744725.1	type II secretion system F family protein	Machinery gene
LZE81_RS14980 (LZE81_14980)	-	3463460..3464323 (+)	864	WP_058359048.1	A24 family peptidase	-
LZE81_RS14985 (LZE81_14985)	coaE	3464337..3464957 (+)	621	WP_058360087.1	dephospho-CoA kinase	-
LZE81_RS14990 (LZE81_14990)	-	3465080..3466414 (-)	1335	WP_058360086.1	HAMP domain-containing sensor histidine kinase	-

Sequence

Protein

Download Length: 143 a.a. Molecular weight: 14990.20 Da Isoelectric Point: 8.4700

                                >NTDB_id=639964 LZE81_RS14970 WP_060744724.1 3461378..3461809(-) (pilA/pilAI) [Xanthomonas translucens strain B1FA]

MKKQQGFTLIELMIVVAIIAILAAIAIPMYQDYVVKSQATSALAEITPGKVGFETAINQGKTPSTTATDDGYIGIPTTTT

YCNVGLGTTATGNITCTAKGGNASKFNTKKIIWTRDDNGAWTCTSDLDAKYRPGSCGVVAATK

Nucleotide

Download Length: 432 bp

                                >NTDB_id=639964 LZE81_RS14970 WP_060744724.1 3461378..3461809(-) (pilA/pilAI) [Xanthomonas translucens strain B1FA]

ATGAAGAAGCAACAGGGCTTTACCCTGATCGAACTGATGATCGTTGTCGCGATCATCGCGATCTTGGCCGCCATCGCAAT

CCCGATGTACCAGGACTATGTTGTCAAGTCGCAAGCTACCTCGGCGCTGGCCGAAATCACCCCGGGCAAGGTTGGGTTCG

AAACCGCGATCAATCAAGGCAAGACGCCCAGCACCACTGCTACGGATGACGGCTATATTGGTATCCCAACCACGACCACC

TATTGCAACGTTGGCCTGGGTACCACTGCCACTGGCAATATCACCTGTACCGCAAAGGGTGGTAATGCCAGTAAGTTCAA

TACCAAGAAGATCATTTGGACGCGTGACGACAATGGCGCATGGACTTGCACCAGTGATCTGGATGCCAAGTATCGTCCCG

GTAGCTGTGGTGTCGTTGCTGCTACGAAGTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Pilin (bacterial filament) (Pilin)

(35-136)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A120EV69

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA/pilAI	Pseudomonas stutzeri DSM 10701	68.421	93.007	0.636
pilA/pilAII	Pseudomonas stutzeri DSM 10701	59.091	92.308	0.545
pilA	Pseudomonas aeruginosa PAK	46.622	100	0.483
pilA	Acinetobacter baumannii strain A118	47.518	98.601	0.469
pilA2	Legionella pneumophila strain ERS1305867	44.928	96.503	0.434
pilA2	Legionella pneumophila str. Paris	44.928	96.503	0.434
pilA	Ralstonia pseudosolanacearum GMI1000	37.126	100	0.434
pilA	Vibrio cholerae C6706	42.857	97.902	0.42
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	42.857	97.902	0.42
pilA	Vibrio cholerae strain A1552	42.857	97.902	0.42
comP	Acinetobacter baylyi ADP1	38.816	100	0.413
pilE	Neisseria gonorrhoeae MS11	35.256	100	0.385
pilA	Haemophilus influenzae Rd KW20	38.028	99.301	0.378
pilE	Neisseria gonorrhoeae strain FA1090	34.177	100	0.378

Detailed information NTG0639964