Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | LXA49_RS10055 | Genome accession | NZ_CP089949 |
| Coordinates | 1942930..1943253 (-) | Length | 107 a.a. |
| NCBI ID | WP_000738628.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain SN75752 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1937930..1948253
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LXA49_RS10015 (LXA49_10000) | rnpA | 1937950..1938321 (-) | 372 | WP_000739246.1 | ribonuclease P protein component | - |
| LXA49_RS11180 | - | 1938338..1938469 (-) | 132 | WP_000768904.1 | hypothetical protein | - |
| LXA49_RS10020 (LXA49_10005) | - | 1938470..1939660 (-) | 1191 | WP_000167765.1 | acetate kinase | - |
| LXA49_RS10025 (LXA49_10010) | comYH | 1939711..1940664 (-) | 954 | WP_000345126.1 | class I SAM-dependent methyltransferase | Machinery gene |
| LXA49_RS10030 (LXA49_10015) | - | 1940725..1941317 (-) | 593 | Protein_1976 | methyltransferase domain-containing protein | - |
| LXA49_RS10035 (LXA49_10020) | comGG/cglG | 1941420..1941866 (-) | 447 | WP_001809944.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LXA49_RS10040 (LXA49_10025) | comGF/cglF | 1941844..1942305 (-) | 462 | WP_000250531.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LXA49_RS10045 (LXA49_10030) | comGE/cglE | 1942268..1942570 (-) | 303 | WP_000413382.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LXA49_RS10050 (LXA49_10035) | comGD/cglD | 1942533..1942967 (-) | 435 | WP_033606693.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LXA49_RS10055 (LXA49_10040) | comGC/cglC | 1942930..1943253 (-) | 324 | WP_000738628.1 | comG operon protein ComGC | Machinery gene |
| LXA49_RS10060 (LXA49_10045) | comGB/cglB | 1943255..1944271 (-) | 1017 | WP_078130737.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LXA49_RS10065 (LXA49_10050) | comGA/cglA/cilD | 1944219..1945160 (-) | 942 | WP_000249536.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LXA49_RS10070 (LXA49_10055) | - | 1945236..1945601 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| LXA49_RS10075 (LXA49_10060) | - | 1945752..1946810 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| LXA49_RS10080 (LXA49_10065) | nagA | 1946973..1948124 (-) | 1152 | WP_252948148.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
Sequence
Protein
Download Length: 107 a.a. Molecular weight: 12232.41 Da Isoelectric Point: 9.8887
>NTDB_id=639449 LXA49_RS10055 WP_000738628.1 1942930..1943253(-) (comGC/cglC) [Streptococcus pneumoniae strain SN75752]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQD
DGRITEEQAKAYKEYHDKQNTSQIVKD
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQD
DGRITEEQAKAYKEYHDKQNTSQIVKD
Nucleotide
Download Length: 324 bp
>NTDB_id=639449 LXA49_RS10055 WP_000738628.1 1942930..1943253(-) (comGC/cglC) [Streptococcus pneumoniae strain SN75752]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGAC
GATGGACGCATCACGGAAGAACAGGCTAAAGCCTATAAAGAATACCATGATAAACAAAATACTAGTCAAATCGTTAAAGA
TTAA
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGAC
GATGGACGCATCACGGAAGAACAGGCTAAAGCCTATAAAGAATACCATGATAAACAAAATACTAGTCAAATCGTTAAAGA
TTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus mitis NCTC 12261 |
93.458 |
100 |
0.935 |
| comGC/cglC | Streptococcus pneumoniae D39 |
94.175 |
96.262 |
0.907 |
| comGC/cglC | Streptococcus pneumoniae R6 |
94.175 |
96.262 |
0.907 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
94.175 |
96.262 |
0.907 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
93.204 |
96.262 |
0.897 |
| comGC/cglC | Streptococcus mitis SK321 |
88.35 |
96.262 |
0.85 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
69.388 |
91.589 |
0.636 |
| comYC | Streptococcus mutans UA140 |
64.211 |
88.785 |
0.57 |
| comYC | Streptococcus mutans UA159 |
64.211 |
88.785 |
0.57 |
| comYC | Streptococcus suis isolate S10 |
69.136 |
75.701 |
0.523 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
54.639 |
90.654 |
0.495 |
| comGC | Staphylococcus aureus MW2 |
48.837 |
80.374 |
0.393 |
| comGC | Staphylococcus aureus N315 |
48.837 |
80.374 |
0.393 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.349 |
80.374 |
0.364 |