Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KP952_RS16020 Genome accession   NZ_CP076731
Coordinates   3018580..3018720 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain Miz-8     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3013580..3023720
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KP952_RS15995 (KP952_15995) yuxO 3013857..3014237 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  KP952_RS16000 (KP952_16000) comA 3014256..3014900 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KP952_RS16005 (KP952_16005) comP 3014981..3017293 (-) 2313 WP_103330147.1 sensor histidine kinase Regulator
  KP952_RS16010 (KP952_16010) comX 3017309..3017530 (-) 222 WP_014480704.1 competence pheromone ComX -
  KP952_RS16015 (KP952_16015) comQ 3017532..3018395 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  KP952_RS16020 (KP952_16020) degQ 3018580..3018720 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KP952_RS16025 (KP952_16025) - 3018942..3019067 (+) 126 WP_003228793.1 hypothetical protein -
  KP952_RS16030 (KP952_16030) - 3019182..3019550 (+) 369 WP_046381300.1 hypothetical protein -
  KP952_RS16035 (KP952_16035) pdeH 3019526..3020755 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  KP952_RS16040 (KP952_16040) pncB 3020891..3022363 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KP952_RS16045 (KP952_16045) pncA 3022379..3022930 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  KP952_RS16050 (KP952_16050) yueI 3023027..3023425 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=504473 KP952_RS16020 WP_003220708.1 3018580..3018720(-) (degQ) [Bacillus subtilis subsp. subtilis strain Miz-8]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=504473 KP952_RS16020 WP_003220708.1 3018580..3018720(-) (degQ) [Bacillus subtilis subsp. subtilis strain Miz-8]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1