NTDB

Overview

Name	comP	Type	Machinery gene
Locus tag	pbN1_RS11805	Genome accession	NZ_CP059467
Coordinates	2498388..2498813 (-)	Length	141 a.a.
NCBI ID	WP_169201657.1	Uniprot ID	-
Organism	Aromatoleum bremense strain PbN1
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2493388..2503813

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
pbN1_RS11790 (pbN1_23970)	-	2494334..2494981 (-)	648	WP_169201660.1	methyltransferase domain-containing protein	-
pbN1_RS11795 (pbN1_23980)	-	2494978..2497926 (-)	2949	WP_169201659.1	hypothetical protein	-
pbN1_RS11800 (pbN1_23990)	-	2497990..2498325 (-)	336	WP_169201658.1	hypothetical protein	-
pbN1_RS11805 (pbN1_24000)	comP	2498388..2498813 (-)	426	WP_169201657.1	pilin	Machinery gene
pbN1_RS11810 (pbN1_24010)	-	2499014..2499385 (+)	372	WP_210147479.1	nucleotidyltransferase domain-containing protein	-
pbN1_RS11815 (pbN1_24020)	-	2499382..2499861 (+)	480	WP_169201656.1	hypothetical protein	-
pbN1_RS11820 (pbN1_24030)	ampD	2499951..2500538 (+)	588	WP_169201655.1	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	-
pbN1_RS11825 (pbN1_24040)	-	2500543..2500893 (-)	351	WP_169201654.1	hypothetical protein	-
pbN1_RS11830 (pbN1_24050)	-	2501018..2501662 (-)	645	WP_169201653.1	LUD domain-containing protein	-
pbN1_RS11835 (pbN1_24060)	-	2501659..2503065 (-)	1407	WP_169201652.1	LutB/LldF family L-lactate oxidation iron-sulfur protein	-

Sequence

Protein

Download Length: 141 a.a. Molecular weight: 14057.28 Da Isoelectric Point: 8.4866

                                >NTDB_id=469761 pbN1_RS11805 WP_169201657.1 2498388..2498813(-) (comP) [Aromatoleum bremense strain PbN1]

MKKVQQGFTLIELMIVVAIIGILAAVALPAYQNYTIRAKVSELVLAASSARTCITEVYQSVGGASVPTTVAADCAITATG

KVTGATVTDGGVVSVAGSTATTSVGAAVTVTLTPAVQSAAGTLTWKCTGSDTKYVPASCRA

Nucleotide

Download Length: 426 bp

                                >NTDB_id=469761 pbN1_RS11805 WP_169201657.1 2498388..2498813(-) (comP) [Aromatoleum bremense strain PbN1]

ATGAAGAAGGTTCAACAGGGTTTTACGCTGATCGAACTGATGATTGTTGTGGCAATCATCGGCATTCTTGCGGCAGTCGC

ATTGCCTGCATACCAGAACTACACGATTCGCGCCAAGGTCTCGGAATTGGTGCTGGCTGCCAGTAGCGCGCGCACCTGCA

TCACCGAGGTCTATCAATCGGTCGGCGGCGCGTCGGTCCCGACGACCGTTGCAGCCGACTGCGCTATCACCGCCACTGGA

AAGGTAACCGGCGCAACGGTGACGGACGGCGGCGTCGTCTCGGTGGCCGGCAGCACCGCTACGACTTCCGTCGGCGCCGC

CGTCACAGTTACACTAACGCCGGCGGTCCAGTCGGCTGCCGGTACGCTGACCTGGAAATGCACCGGCTCCGACACCAAGT

ACGTCCCCGCATCCTGCCGCGCCTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(37-140)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-28)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comP	Acinetobacter baylyi ADP1	48.322	100	0.511
pilA2	Legionella pneumophila strain ERS1305867	47.143	99.291	0.468
pilA2	Legionella pneumophila str. Paris	47.143	99.291	0.468
pilA/pilA1	Eikenella corrodens VA1	42.038	100	0.468
pilA	Ralstonia pseudosolanacearum GMI1000	37.278	100	0.447
pilE	Neisseria gonorrhoeae strain FA1090	38.75	100	0.44
pilE	Neisseria gonorrhoeae MS11	36.646	100	0.418
pilA	Acinetobacter baumannii strain A118	39.597	100	0.418
pilA/pilAII	Pseudomonas stutzeri DSM 10701	37.179	100	0.411
pilA	Pseudomonas aeruginosa PAK	36.601	100	0.397
pilA	Haemophilus influenzae Rd KW20	36.806	100	0.376
pilA	Glaesserella parasuis strain SC1401	34.211	100	0.369
pilA	Haemophilus influenzae 86-028NP	36.62	100	0.369
pilA	Vibrio cholerae C6706	34.899	100	0.369
pilA	Vibrio cholerae strain A1552	34.899	100	0.369
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	34.899	100	0.369

Detailed information NTG0469761