NTDB

Detailed information

Bioinformatically predicted

Overview
Genomic Context
Sequence
Domains
Secondary structure
3D structure
Transmembrane helices
Similar proteins

Overview

Name	comE	Type	Machinery gene
Locus tag	HP555_RS02480	Genome accession	NZ_CP054140
Coordinates	546879..547133 (+)	Length	84 a.a.
NCBI ID	WP_199263640.1	Uniprot ID	A0A7T6APM4
Organism	Desulfobulbus oligotrophicus strain Prop6
Function	DNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 541879..552133

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HP555_RS02465 (HP555_02465)	-	542970..543557 (-)	588	WP_199263637.1	hypothetical protein	-
HP555_RS02470 (HP555_02470)	-	543569..545107 (-)	1539	WP_199263638.1	HAMP domain-containing sensor histidine kinase	-
HP555_RS02475 (HP555_02475)	-	545114..546085 (-)	972	WP_332908650.1	VanZ family protein	-
HP555_RS02480 (HP555_02480)	comE	546879..547133 (+)	255	WP_199263640.1	helix-hairpin-helix domain-containing protein	Machinery gene
HP555_RS02490 (HP555_02490)	-	547557..548972 (-)	1416	WP_199263641.1	sigma-54 dependent transcriptional regulator	-
HP555_RS02495 (HP555_02495)	-	548969..550195 (-)	1227	WP_199263642.1	ATP-binding protein	-

Sequence

Protein

Download Length: 84 a.a. Molecular weight: 9243.77 Da Isoelectric Point: 7.9666

                                >NTDB_id=451079 HP555_RS02480 WP_199263640.1 546879..547133(+) (comE) [Desulfobulbus oligotrophicus strain Prop6]

MKRFYLTLVFLLCLVTAAFAKVNINSATTEELATLKGIGKVKAEAIVAYRSTNGDFKTVEDLTKVKGIGNKIFENIKDDI

SVDE

Nucleotide

Download Length: 255 bp

                                >NTDB_id=451079 HP555_RS02480 WP_199263640.1 546879..547133(+) (comE) [Desulfobulbus oligotrophicus strain Prop6]

ATGAAACGATTTTATCTAACACTGGTATTCTTGCTTTGTTTGGTCACCGCCGCCTTTGCCAAGGTCAACATCAACAGCGC

CACTACCGAAGAATTGGCAACACTTAAAGGTATTGGTAAAGTAAAAGCCGAAGCTATTGTTGCCTATCGTTCCACCAACG

GTGATTTCAAAACAGTCGAAGACCTCACCAAGGTTAAGGGCATCGGCAACAAAATTTTCGAAAACATCAAAGACGACATC

TCTGTCGACGAGTAA

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(20-80)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A7T6APM4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comEA	Vibrio campbellii strain DS40M4	44.086	100	0.488
comE	Neisseria gonorrhoeae MS11	48.235	100	0.488
comE	Neisseria gonorrhoeae MS11	48.235	100	0.488
comE	Neisseria gonorrhoeae MS11	48.235	100	0.488
comE	Neisseria gonorrhoeae MS11	48.235	100	0.488
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	51.948	91.667	0.476
comEA	Bacillus subtilis subsp. subtilis str. 168	61.905	75	0.464
comEA	Lactococcus lactis subsp. cremoris KW2	52.941	80.952	0.429
comEA	Vibrio parahaemolyticus RIMD 2210633	56.667	71.429	0.405
comEA	Acinetobacter baylyi ADP1	54.839	73.81	0.405
comEA	Latilactobacillus sakei subsp. sakei 23K	50	80.952	0.405
comEA	Vibrio cholerae strain A1552	61.818	65.476	0.405
comEA	Vibrio cholerae C6706	61.818	65.476	0.405
comEA/comE1	Glaesserella parasuis strain SC1401	50.794	75	0.381
comEA/celA/cilE	Streptococcus pneumoniae TIGR4	47.059	80.952	0.381
comEA/celA/cilE	Streptococcus mitis NCTC 12261	47.059	80.952	0.381
comEA/celA/cilE	Streptococcus mitis SK321	45.588	80.952	0.369
comEA/celA/cilE	Streptococcus pneumoniae Rx1	49.206	75	0.369
comEA/celA/cilE	Streptococcus pneumoniae R6	49.206	75	0.369
comEA/celA/cilE	Streptococcus pneumoniae D39	49.206	75	0.369

Detailed information NTG0451079