Detailed information NTG0450143

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: FOC63_RS04600
• Genome accession: NZ_CP054015
• Coordinates: 908754..909047 (+)
• Length: 97 a.a.
• NCBI ID: WP_009853231.1
• Uniprot ID: -
• Organism: Streptococcus gallolyticus strain FDAARGOS_755
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 903754..914047

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FOC63_RS04585 (FOC63_04585)	-	906407..906775 (+)	369	WP_009853228.1	DUF1033 family protein	-
FOC63_RS04590 (FOC63_04590)	comYA	906846..907787 (+)	942	WP_009853229.1	competence type IV pilus ATPase ComGA	Machinery gene
FOC63_RS04595 (FOC63_04595)	comYB	907669..908754 (+)	1086	WP_012961328.1	competence type IV pilus assembly protein ComGB	Machinery gene
FOC63_RS04600 (FOC63_04600)	comYC	908754..909047 (+)	294	WP_009853231.1	competence type IV pilus major pilin ComGC	Machinery gene
FOC63_RS04605 (FOC63_04605)	comYD	909031..909462 (+)	432	WP_009853232.1	competence type IV pilus minor pilin ComGD	Machinery gene
FOC63_RS04610 (FOC63_04610)	comGE	909416..909709 (+)	294	WP_012961329.1	competence type IV pilus minor pilin ComGE	-
FOC63_RS04615 (FOC63_04615)	comYF	909663..910130 (+)	468	WP_012961330.1	competence type IV pilus minor pilin ComGF	Machinery gene
FOC63_RS04620 (FOC63_04620)	comYG	910102..910416 (+)	315	WP_009853235.1	competence type IV pilus minor pilin ComGG	Machinery gene
FOC63_RS04625 (FOC63_04625)	comYH	910489..911445 (+)	957	WP_009853236.1	class I SAM-dependent methyltransferase	Machinery gene
FOC63_RS04630 (FOC63_04630)	-	911498..912697 (+)	1200	WP_009853237.1	acetate kinase	-
FOC63_RS04635 (FOC63_04635)	-	912859..913059 (+)	201	WP_012961332.1	helix-turn-helix transcriptional regulator	-
FOC63_RS04640 (FOC63_04640)	-	913069..913278 (+)	210	WP_009853239.1	hypothetical protein	-
FOC63_RS04645 (FOC63_04645)	-	913291..913743 (+)	453	WP_009853240.1	hypothetical protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 11042.18 Da
• Isoelectric Point: 9.9310

>NTDB_id=450143 FOC63_RS04600 WP_009853231.1 908754..909047(+) (comYC) [Streptococcus gallolyticus strain FDAARGOS_755]
MKKIWKKLRQKTVKGFTLVEMLIVLLIISVLMLLFVPNLSKQKDVVREKGDAAVVKVVESQMDLYEVKTGDKPTVDDLVE
VGYITSEQAKTYNEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=450143 FOC63_RS04600 WP_009853231.1 908754..909047(+) (comYC) [Streptococcus gallolyticus strain FDAARGOS_755]
ATGAAAAAGATTTGGAAAAAATTACGTCAGAAAACGGTAAAAGGGTTCACACTTGTGGAGATGTTGATTGTGCTTCTTAT
TATCAGTGTTTTAATGTTGCTTTTTGTACCGAATTTGAGTAAGCAAAAGGACGTTGTTCGTGAAAAAGGCGATGCTGCTG
TTGTGAAAGTGGTAGAGAGCCAAATGGATTTGTACGAAGTGAAAACGGGAGATAAACCAACTGTTGATGATTTAGTTGAA
GTTGGCTACATCACTTCTGAACAAGCAAAAACTTACAATGAAGCTAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	67.391	94.845	0.639
comYC	Streptococcus gordonii str. Challis substr. CH1	64.773	90.722	0.588
comGC/cglC	Streptococcus mitis SK321	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae R6	59.574	96.907	0.577
comGC/cglC	Streptococcus mitis NCTC 12261	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae TIGR4	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae Rx1	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae D39	59.574	96.907	0.577
comYC	Streptococcus mutans UA140	58.427	91.753	0.536
comYC	Streptococcus mutans UA159	58.427	91.753	0.536
comGC	Lactococcus lactis subsp. cremoris KW2	56.667	92.784	0.526