Detailed information NTG0409428

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: GPZ88_RS05065
• Genome accession: NZ_CP046919
• Coordinates: 972708..973001 (+)
• Length: 97 a.a.
• NCBI ID: WP_074561132.1
• Uniprot ID: A0A6G8I001
• Organism: Streptococcus ruminicola strain CNU_G2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 967708..978001

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GPZ88_RS05050 (GPZ88_05015)	-	970362..970730 (+)	369	WP_166043601.1	DUF1033 family protein	-
GPZ88_RS05055 (GPZ88_05020)	comYA	970800..971741 (+)	942	WP_166043603.1	competence type IV pilus ATPase ComGA	Machinery gene
GPZ88_RS05060 (GPZ88_05025)	comYB	971665..972708 (+)	1044	WP_206282135.1	competence type IV pilus assembly protein ComGB	Machinery gene
GPZ88_RS05065 (GPZ88_05030)	comGC/cglC	972708..973001 (+)	294	WP_074561132.1	competence type IV pilus major pilin ComGC	Machinery gene
GPZ88_RS05070 (GPZ88_05035)	comYD	972985..973416 (+)	432	WP_157628644.1	competence type IV pilus minor pilin ComGD	Machinery gene
GPZ88_RS05075 (GPZ88_05040)	comYE	973370..973663 (+)	294	WP_166043607.1	competence type IV pilus minor pilin ComGE	Machinery gene
GPZ88_RS05080 (GPZ88_05045)	comYF	973647..974084 (+)	438	WP_133018089.1	competence type IV pilus minor pilin ComGF	Machinery gene
GPZ88_RS05085 (GPZ88_05050)	comGG	974056..974406 (+)	351	WP_133018088.1	competence type IV pilus minor pilin ComGG	-
GPZ88_RS05090 (GPZ88_05055)	comYH	974460..975416 (+)	957	WP_006531743.1	class I SAM-dependent methyltransferase	Machinery gene
GPZ88_RS05095 (GPZ88_05060)	-	975470..976669 (+)	1200	WP_166043609.1	acetate kinase	-
GPZ88_RS05100 (GPZ88_05065)	-	976829..977026 (+)	198	WP_074561137.1	helix-turn-helix transcriptional regulator	-
GPZ88_RS05105 (GPZ88_05070)	-	977042..977242 (+)	201	WP_074965270.1	hypothetical protein	-
GPZ88_RS05110 (GPZ88_05075)	-	977243..977698 (+)	456	WP_240915112.1	ABC transporter permease	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 10995.12 Da
• Isoelectric Point: 9.6932

>NTDB_id=409428 GPZ88_RS05065 WP_074561132.1 972708..973001(+) (comGC/cglC) [Streptococcus ruminicola strain CNU_G2]
MKKIWKKLRKKSVEAFTLVEMLIVLLIIGVLMLLFVPNLSKQKDVVHEKGDAAVVKVVESQMDLYEVKTGDKASVDDLVD
IGYITKEQAKTYNEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=409428 GPZ88_RS05065 WP_074561132.1 972708..973001(+) (comGC/cglC) [Streptococcus ruminicola strain CNU_G2]
ATGAAAAAAATTTGGAAAAAACTACGTAAAAAGTCTGTGGAAGCTTTCACACTTGTGGAGATGTTGATTGTTTTGCTAAT
CATTGGTGTCTTAATGCTGTTATTTGTGCCAAATTTGAGTAAGCAAAAGGATGTTGTGCATGAAAAAGGAGATGCTGCTG
TTGTCAAAGTTGTCGAAAGTCAGATGGACCTTTATGAGGTGAAGACAGGTGATAAGGCAAGTGTTGATGATTTAGTAGAC
ATTGGCTACATTACGAAAGAGCAAGCCAAAACCTATAATGAAGCTAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

3D structure

• AlphaFold DB: A0A6G8I001

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	62.766	96.907	0.608
comYC	Streptococcus suis isolate S10	64.13	94.845	0.608
comGC/cglC	Streptococcus pneumoniae Rx1	61.702	96.907	0.598
comGC/cglC	Streptococcus mitis NCTC 12261	61.702	96.907	0.598
comGC/cglC	Streptococcus pneumoniae R6	61.702	96.907	0.598
comGC/cglC	Streptococcus pneumoniae D39	61.702	96.907	0.598
comGC/cglC	Streptococcus pneumoniae TIGR4	61.702	96.907	0.598
comYC	Streptococcus gordonii str. Challis substr. CH1	65.517	89.691	0.588
comYC	Streptococcus mutans UA140	60.92	89.691	0.546
comYC	Streptococcus mutans UA159	60.92	89.691	0.546
comGC	Lactococcus lactis subsp. cremoris KW2	53.333	92.784	0.495
comGC	Staphylococcus aureus MW2	45.122	84.536	0.381
comGC	Staphylococcus aureus N315	45.122	84.536	0.381
comGC	Latilactobacillus sakei subsp. sakei 23K	43.023	88.66	0.381