Detailed information NTG0367247

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: FDP16_RS10330
• Genome accession: NZ_CP040798
• Coordinates: 2088167..2088484 (-)
• Length: 105 a.a.
• NCBI ID: WP_002896769.1
• Uniprot ID: F3SKF6
• Organism: Streptococcus sanguinis strain CGMH058
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2083167..2093484

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FDP16_RS10295 (FDP16_10755)	-	2083550..2084299 (-)	750	WP_176799577.1	CPBP family intramembrane glutamic endopeptidase	-
FDP16_RS10300 (FDP16_10760)	-	2084446..2085636 (-)	1191	WP_176799578.1	acetate kinase	-
FDP16_RS10305 (FDP16_10765)	comYH	2085673..2086638 (-)	966	WP_124765830.1	class I SAM-dependent methyltransferase	Machinery gene
FDP16_RS10310 (FDP16_10770)	comGG	2086720..2087112 (-)	393	WP_176799579.1	competence type IV pilus minor pilin ComGG	-
FDP16_RS10315 (FDP16_10775)	comGF/cglF	2087093..2087530 (-)	438	WP_176799580.1	competence type IV pilus minor pilin ComGF	Machinery gene
FDP16_RS10320 (FDP16_10780)	comGE/cglE	2087514..2087807 (-)	294	WP_176799581.1	competence type IV pilus minor pilin ComGE	Machinery gene
FDP16_RS10325 (FDP16_10785)	comYD	2087773..2088207 (-)	435	WP_176799582.1	competence type IV pilus minor pilin ComGD	Machinery gene
FDP16_RS10330 (FDP16_10790)	comYC	2088167..2088484 (-)	318	WP_002896769.1	competence type IV pilus major pilin ComGC	Machinery gene
FDP16_RS10335 (FDP16_10795)	comYB	2088484..2089518 (-)	1035	WP_256254487.1	competence type IV pilus assembly protein ComGB	Machinery gene
FDP16_RS10340 (FDP16_10800)	comYA	2089448..2090389 (-)	942	WP_002896773.1	competence type IV pilus ATPase ComGA	Machinery gene
FDP16_RS10345 (FDP16_10805)	-	2090519..2090899 (-)	381	WP_176799584.1	DUF1033 family protein	-
FDP16_RS10350 (FDP16_10810)	-	2091038..2092099 (-)	1062	WP_176799585.1	zinc-dependent alcohol dehydrogenase family protein	-
FDP16_RS10355 (FDP16_10815)	-	2092269..2093375 (-)	1107	WP_176799586.1	glycosyl hydrolase family 8	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11400.28 Da
• Isoelectric Point: 9.6959

>NTDB_id=367247 FDP16_RS10330 WP_002896769.1 2088167..2088484(-) (comYC) [Streptococcus sanguinis strain CGMH058]
MKKLNTLKVQAFTLVEMLIVLLVISVLLLLFVPNLTKQKDAVSDTGTAAVVKVVESQAELYELKNTNEKASLSKLVSAGN
ISQKQADSYKAYYGKHSGETQAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=367247 FDP16_RS10330 WP_002896769.1 2088167..2088484(-) (comYC) [Streptococcus sanguinis strain CGMH058]
ATGAAAAAACTTAATACCTTAAAAGTTCAAGCATTCACCCTTGTGGAAATGCTGATTGTTTTGCTGGTTATCAGCGTGCT
CTTGCTGCTCTTTGTGCCTAATCTGACCAAGCAAAAAGATGCTGTTTCAGATACAGGAACGGCAGCGGTGGTCAAGGTGG
TAGAAAGCCAGGCGGAGCTCTATGAACTGAAGAATACCAATGAAAAGGCTAGCCTAAGCAAGCTGGTCAGCGCAGGAAAT
ATCAGCCAGAAACAGGCAGATTCTTATAAGGCTTACTATGGAAAACACAGTGGCGAAACTCAAGCGGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-30)

3D structure

• AlphaFold DB: F3SKF6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	82.857	100	0.829
comYC	Streptococcus mutans UA159	68.571	100	0.686
comYC	Streptococcus mutans UA140	68.571	100	0.686
comGC/cglC	Streptococcus mitis NCTC 12261	65.138	100	0.676
comGC/cglC	Streptococcus mitis SK321	65.421	100	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	63.551	100	0.648
comGC/cglC	Streptococcus pneumoniae D39	63.551	100	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	63.551	100	0.648
comGC/cglC	Streptococcus pneumoniae R6	63.551	100	0.648
comGC	Lactococcus lactis subsp. cremoris KW2	59	95.238	0.562
comYC	Streptococcus suis isolate S10	61.798	84.762	0.524
comGC	Staphylococcus aureus MW2	43.878	93.333	0.41
comGC	Staphylococcus aureus N315	43.878	93.333	0.41