Detailed information NTG0367246

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: FDP16_RS10325
• Genome accession: NZ_CP040798
• Coordinates: 2087773..2088207 (-)
• Length: 144 a.a.
• NCBI ID: WP_176799582.1
• Uniprot ID: -
• Organism: Streptococcus sanguinis strain CGMH058
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2082773..2093207

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FDP16_RS10290 (FDP16_10750)	-	2082794..2083432 (-)	639	WP_176799576.1	type II CAAX prenyl endopeptidase Rce1 family protein	-
FDP16_RS10295 (FDP16_10755)	-	2083550..2084299 (-)	750	WP_176799577.1	CPBP family intramembrane glutamic endopeptidase	-
FDP16_RS10300 (FDP16_10760)	-	2084446..2085636 (-)	1191	WP_176799578.1	acetate kinase	-
FDP16_RS10305 (FDP16_10765)	comYH	2085673..2086638 (-)	966	WP_124765830.1	class I SAM-dependent methyltransferase	Machinery gene
FDP16_RS10310 (FDP16_10770)	comGG	2086720..2087112 (-)	393	WP_176799579.1	competence type IV pilus minor pilin ComGG	-
FDP16_RS10315 (FDP16_10775)	comGF/cglF	2087093..2087530 (-)	438	WP_176799580.1	competence type IV pilus minor pilin ComGF	Machinery gene
FDP16_RS10320 (FDP16_10780)	comGE/cglE	2087514..2087807 (-)	294	WP_176799581.1	competence type IV pilus minor pilin ComGE	Machinery gene
FDP16_RS10325 (FDP16_10785)	comYD	2087773..2088207 (-)	435	WP_176799582.1	competence type IV pilus minor pilin ComGD	Machinery gene
FDP16_RS10330 (FDP16_10790)	comYC	2088167..2088484 (-)	318	WP_002896769.1	competence type IV pilus major pilin ComGC	Machinery gene
FDP16_RS10335 (FDP16_10795)	comYB	2088484..2089518 (-)	1035	WP_256254487.1	competence type IV pilus assembly protein ComGB	Machinery gene
FDP16_RS10340 (FDP16_10800)	comYA	2089448..2090389 (-)	942	WP_002896773.1	competence type IV pilus ATPase ComGA	Machinery gene
FDP16_RS10345 (FDP16_10805)	-	2090519..2090899 (-)	381	WP_176799584.1	DUF1033 family protein	-
FDP16_RS10350 (FDP16_10810)	-	2091038..2092099 (-)	1062	WP_176799585.1	zinc-dependent alcohol dehydrogenase family protein	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16439.95 Da
• Isoelectric Point: 9.3997

>NTDB_id=367246 FDP16_RS10325 WP_176799582.1 2087773..2088207(-) (comYD) [Streptococcus sanguinis strain CGMH058]
MENTVAKLKRLPIKAFTLLESLLVLFVVSFLLLGLSGSIRAGFNQVQEQLFFLEFERLYQETQRLSLAGHEKLSLKISGR
QISNGYQELDFPQTLQEHEQQVIQFDRAGGNSSLSKIIFQMEDRTVVYQLYMGNGKFKKTTASS

Nucleotide

• Length: 435 bp

>NTDB_id=367246 FDP16_RS10325 WP_176799582.1 2087773..2088207(-) (comYD) [Streptococcus sanguinis strain CGMH058]
ATGGAAAACACAGTGGCGAAACTCAAGCGGTTGCCAATTAAGGCTTTTACACTGCTGGAAAGTCTCCTCGTTCTTTTTGT
TGTTAGTTTTCTACTACTAGGCTTATCTGGCTCGATAAGGGCCGGCTTCAATCAGGTTCAAGAGCAACTCTTCTTTTTAG
AGTTTGAGAGGCTCTATCAGGAGACGCAGAGGCTGAGTTTAGCTGGGCATGAGAAACTGTCTCTGAAGATTTCAGGACGG
CAGATTTCCAATGGCTATCAAGAACTGGATTTTCCGCAAACTTTGCAGGAACATGAGCAGCAGGTCATTCAGTTTGATCG
GGCTGGCGGGAACTCATCGCTCAGCAAGATTATTTTTCAGATGGAGGACAGGACAGTTGTTTACCAGCTTTATATGGGCA
ATGGCAAGTTTAAAAAGACGACAGCTTCAAGCTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus gordonii str. Challis substr. CH1	58.156	97.917	0.569
comGD/cglD	Streptococcus mitis NCTC 12261	56.818	91.667	0.521
comGD/cglD	Streptococcus pneumoniae Rx1	57.48	88.194	0.507
comGD/cglD	Streptococcus pneumoniae D39	57.48	88.194	0.507
comGD/cglD	Streptococcus pneumoniae R6	57.48	88.194	0.507
comGD/cglD	Streptococcus mitis SK321	57.48	88.194	0.507
comGD/cglD	Streptococcus pneumoniae TIGR4	56.693	88.194	0.5
comYD	Streptococcus mutans UA140	48.837	89.583	0.437
comYD	Streptococcus mutans UA159	48.837	89.583	0.437
comGD	Lactococcus lactis subsp. cremoris KW2	41.221	90.972	0.375