Detailed information NTG0304866

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: DV130_RS09250
• Genome accession: NZ_CP031248
• Coordinates: 1726240..1726563 (+)
• Length: 107 a.a.
• NCBI ID: WP_000738628.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain M26365
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1721240..1731563

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DV130_RS09225	nagA	1721369..1722520 (+)	1152	WP_001134457.1	N-acetylglucosamine-6-phosphate deacetylase	-
DV130_RS09230	-	1722683..1723741 (+)	1059	WP_000649470.1	zinc-dependent alcohol dehydrogenase family protein	-
DV130_RS09235	-	1723892..1724257 (+)	366	WP_000286415.1	DUF1033 family protein	-
DV130_RS09240	comGA/cglA/cilD	1724333..1725274 (+)	942	WP_000249571.1	competence type IV pilus ATPase ComGA	Machinery gene
DV130_RS09245	comGB/cglB	1725222..1726238 (+)	1017	WP_078130847.1	competence type IV pilus assembly protein ComGB	Machinery gene
DV130_RS09250	comGC/cglC	1726240..1726563 (+)	324	WP_000738628.1	comG operon protein ComGC	Machinery gene
DV130_RS09255	comGD/cglD	1726526..1726960 (+)	435	WP_033606693.1	competence type IV pilus minor pilin ComGD	Machinery gene
DV130_RS09260	comGE/cglE	1726923..1727225 (+)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
DV130_RS09265	comGF/cglF	1727188..1727649 (+)	462	WP_050072687.1	competence type IV pilus minor pilin ComGF	Machinery gene
DV130_RS09270	comGG/cglG	1727627..1728073 (+)	447	WP_050072685.1	competence type IV pilus minor pilin ComGG	Machinery gene
DV130_RS09275	-	1728176..1728770 (+)	595	Protein_1759	methyltransferase domain-containing protein	-
DV130_RS09280	comYH	1728831..1729784 (+)	954	WP_050072683.1	class I SAM-dependent methyltransferase	Machinery gene
DV130_RS09285	-	1729835..1731025 (+)	1191	WP_000167769.1	acetate/propionate family kinase	-
DV130_RS12790	-	1731026..1731157 (+)	132	WP_000768904.1	hypothetical protein	-
DV130_RS09290	rnpA	1731174..1731545 (+)	372	WP_000739244.1	ribonuclease P protein component	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12232.41 Da
• Isoelectric Point: 9.8887

>NTDB_id=304866 DV130_RS09250 WP_000738628.1 1726240..1726563(+) (comGC/cglC) [Streptococcus pneumoniae strain M26365]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQD
DGRITEEQAKAYKEYHDKQNTSQIVKD

Nucleotide

• Length: 324 bp

>NTDB_id=304866 DV130_RS09250 WP_000738628.1 1726240..1726563(+) (comGC/cglC) [Streptococcus pneumoniae strain M26365]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAAATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTAGCCTAAGAAAGCTACAAGAC
GATGGACGCATCACGGAAGAACAGGCTAAAGCCTATAAAGAATACCATGATAAACAAAATACTAGTCAAATCGTTAAAGA
TTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis NCTC 12261	93.458	100	0.935
comGC/cglC	Streptococcus pneumoniae D39	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae R6	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae Rx1	94.175	96.262	0.907
comGC/cglC	Streptococcus pneumoniae TIGR4	93.204	96.262	0.897
comGC/cglC	Streptococcus mitis SK321	88.35	96.262	0.85
comYC	Streptococcus gordonii str. Challis substr. CH1	69.388	91.589	0.636
comYC	Streptococcus mutans UA140	64.211	88.785	0.57
comYC	Streptococcus mutans UA159	64.211	88.785	0.57
comYC	Streptococcus suis isolate S10	69.136	75.701	0.523
comGC	Lactococcus lactis subsp. cremoris KW2	54.639	90.654	0.495
comGC	Staphylococcus aureus MW2	48.837	80.374	0.393
comGC	Staphylococcus aureus N315	48.837	80.374	0.393
comGC	Latilactobacillus sakei subsp. sakei 23K	45.349	80.374	0.364