Detailed information NTG0284675

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: SK637_RS01020
• Genome accession: NZ_CP028415
• Coordinates: 209038..209364 (+)
• Length: 108 a.a.
• NCBI ID: WP_033688035.1
• Uniprot ID: -
• Organism: Streptococcus mitis strain SK637
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 204038..214364

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SK637_RS00995 (SK637_00198)	nagA	204172..205323 (+)	1152	WP_033688030.1	N-acetylglucosamine-6-phosphate deacetylase	-
SK637_RS01000 (SK637_00199)	-	205486..206544 (+)	1059	WP_033688031.1	zinc-dependent alcohol dehydrogenase family protein	-
SK637_RS01005 (SK637_00200)	-	206690..207055 (+)	366	WP_033688032.1	DUF1033 family protein	-
SK637_RS01010 (SK637_00201)	comGA/cglA/cilD	207131..208072 (+)	942	WP_033688033.1	competence type IV pilus ATPase ComGA	Machinery gene
SK637_RS01015 (SK637_00202)	comGB/cglB	208020..209036 (+)	1017	WP_080710441.1	competence type IV pilus assembly protein ComGB	Machinery gene
SK637_RS01020 (SK637_00203)	comGC/cglC	209038..209364 (+)	327	WP_033688035.1	competence type IV pilus major pilin ComGC	Machinery gene
SK637_RS01025 (SK637_00204)	comGD/cglD	209357..209761 (+)	405	WP_000588010.1	competence type IV pilus minor pilin ComGD	Machinery gene
SK637_RS01030 (SK637_00205)	comGE/cglE	209724..210026 (+)	303	WP_272898261.1	competence type IV pilus minor pilin ComGE	Machinery gene
SK637_RS01035 (SK637_00206)	comGF/cglF	209989..210450 (+)	462	WP_033688037.1	competence type IV pilus minor pilin ComGF	Machinery gene
SK637_RS01040 (SK637_00207)	comGG/cglG	210428..210838 (+)	411	WP_033688038.1	competence type IV pilus minor pilin ComGG	Machinery gene
SK637_RS01045 (SK637_00208)	-	210871..211458 (+)	588	WP_033688039.1	class I SAM-dependent methyltransferase	-
SK637_RS01050 (SK637_00209)	comYH	211519..212472 (+)	954	WP_033688040.1	class I SAM-dependent methyltransferase	Machinery gene
SK637_RS01055 (SK637_00210)	-	212522..213712 (+)	1191	WP_033688041.1	acetate kinase	-
SK637_RS01060 (SK637_00211)	rnpA	213862..214233 (+)	372	WP_033688042.1	ribonuclease P protein component	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12080.26 Da
• Isoelectric Point: 10.2400

>NTDB_id=284675 SK637_RS01020 WP_033688035.1 209038..209364(+) (comGC/cglC) [Streptococcus mitis strain SK637]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLLLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLDKNEDASLSKLQA
DGRITKEQAKAYNEYYTKNGGANRKVND

Nucleotide

• Length: 327 bp

>NTDB_id=284675 SK637_RS01020 WP_033688035.1 209038..209364(+) (comGC/cglC) [Streptococcus mitis strain SK637]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCGAAAGTGAAGGCTTTCACACTTGTGGAAATGTTGGTGGTCTTGCTCAT
CATCAGCGTGCTTCTATTACTTTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAACGACAAAGGAAAAGCTGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTAGATAAAAATGAAGATGCTAGCCTAAGCAAGTTACAAGCA
GATGGGCGAATCACAAAAGAACAGGCTAAAGCCTATAATGAATACTATACAAAAAATGGAGGGGCAAATCGTAAAGTCAA
TGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	98.148	100	0.981
comGC/cglC	Streptococcus pneumoniae Rx1	93.519	100	0.935
comGC/cglC	Streptococcus pneumoniae D39	93.519	100	0.935
comGC/cglC	Streptococcus pneumoniae R6	93.519	100	0.935
comGC/cglC	Streptococcus pneumoniae TIGR4	93.519	100	0.935
comGC/cglC	Streptococcus mitis NCTC 12261	95.918	90.741	0.87
comYC	Streptococcus gordonii str. Challis substr. CH1	68.932	95.37	0.657
comYC	Streptococcus mutans UA140	64.706	94.444	0.611
comYC	Streptococcus mutans UA159	64.706	94.444	0.611
comGC	Lactococcus lactis subsp. cremoris KW2	55.882	94.444	0.528
comYC	Streptococcus suis isolate S10	69.136	75	0.519
comGC	Staphylococcus aureus MW2	50	79.63	0.398
comGC	Staphylococcus aureus N315	50	79.63	0.398