Detailed information NTG0226670

Bioinformatically predicted

Overview

• Name: Cj0011c
• Type: Machinery gene
• Locus tag: CCUN_RS00180
• Genome accession: NZ_CP020867
• Coordinates: 25652..25891 (-)
• Length: 79 a.a.
• NCBI ID: WP_027304938.1
• Uniprot ID: A0A1W6BUE7
• Organism: Campylobacter cuniculorum DSM 23162 = LMG 24588
• Function: DNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 20652..30891

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CCUN_RS00165 (CCUN_0032)	-	21686..21916 (-)	231	WP_027304935.1	hypothetical protein	-
CCUN_RS00170 (CCUN_0033)	-	22023..24893 (-)	2871	WP_027304936.1	FAD-binding and (Fe-S)-binding domain-containing protein	-
CCUN_RS00175 (CCUN_0034)	-	25108..25584 (-)	477	WP_051521666.1	ribonuclease HII	-
CCUN_RS00180 (CCUN_0035)	Cj0011c	25652..25891 (-)	240	WP_027304938.1	helix-hairpin-helix domain-containing protein	Machinery gene
CCUN_RS00185 (CCUN_0036)	ilvD	26047..27723 (+)	1677	WP_027304939.1	dihydroxy-acid dehydratase	-
CCUN_RS00190 (CCUN_0037)	-	27928..28842 (+)	915	WP_035175580.1	cytochrome-c peroxidase	-
CCUN_RS00195 (CCUN_0038)	-	28829..30625 (+)	1797	WP_035175582.1	methyl-accepting chemotaxis protein	-

Sequence

Protein

• Length: 79 a.a.
• Molecular weight: 8866.31 Da
• Isoelectric Point: 5.1504

>NTDB_id=226670 CCUN_RS00180 WP_027304938.1 25652..25891(-) (Cj0011c) [Campylobacter cuniculorum DSM 23162 = LMG 24588]
MKKILFLIFAFISLLSAAVNINTASKEELQTLKGIGETKAEAILEYRKDQNFTSIEDIKKVKGIGEKTFEEIKDSISVE

Nucleotide

• Length: 240 bp

>NTDB_id=226670 CCUN_RS00180 WP_027304938.1 25652..25891(-) (Cj0011c) [Campylobacter cuniculorum DSM 23162 = LMG 24588]
ATGAAAAAAATCTTATTTTTAATCTTTGCTTTTATAAGCCTTTTATCTGCAGCTGTTAATATCAATACCGCGAGTAAAGA
AGAACTTCAAACTCTTAAAGGTATAGGTGAAACAAAGGCTGAAGCGATTTTAGAATACCGCAAAGACCAAAATTTCACTA
GCATAGAAGACATTAAAAAGGTTAAAGGCATAGGTGAAAAAACCTTTGAAGAAATCAAAGACTCCATTTCAGTTGAATGA

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (18-76)

3D structure

• AlphaFold DB: A0A1W6BUE7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	65.823	100	0.658
comEA	Vibrio parahaemolyticus RIMD 2210633	43.478	100	0.506
comEA	Bacillus subtilis subsp. subtilis str. 168	60.938	81.013	0.494
comE	Neisseria gonorrhoeae MS11	48.148	100	0.494
comE	Neisseria gonorrhoeae MS11	48.148	100	0.494
comE	Neisseria gonorrhoeae MS11	48.148	100	0.494
comE	Neisseria gonorrhoeae MS11	48.148	100	0.494
comEA	Vibrio campbellii strain DS40M4	37.634	100	0.443
comEA	Vibrio cholerae strain A1552	63.462	65.823	0.418
comEA	Vibrio cholerae C6706	63.462	65.823	0.418
comEA	Lactococcus lactis subsp. cremoris KW2	53.226	78.481	0.418
comEA	Latilactobacillus sakei subsp. sakei 23K	50	81.013	0.405
comEA	Acinetobacter baylyi ADP1	50.82	77.215	0.392
comEA	Staphylococcus aureus N315	50.82	77.215	0.392
comE1/comEA	Haemophilus influenzae Rd KW20	46.97	83.544	0.392
comEA	Staphylococcus aureus MW2	50.82	77.215	0.392
comEA/comE1	Glaesserella parasuis strain SC1401	49.206	79.747	0.392
comEA	Acinetobacter baumannii D1279779	46.875	81.013	0.38
comEA	Acinetobacter baumannii strain A118	45.312	81.013	0.367