Detailed information NTG1032577

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: AB8E26_RS12555
• Genome accession: NZ_CP165963
• Coordinates: 2779293..2779727 (+)
• Length: 144 a.a.
• NCBI ID: WP_369970414.1
• Uniprot ID: -
• Organism: Stenotrophomonas rhizophila strain busan1-1
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	2773591..2781922	2779293..2779727	within	0

Gene organization within MGE regions

Location: 2773591..2781922

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB8E26_RS12525 (AB8E26_12535)	-	2773600..2774064 (+)	465	WP_328803786.1	hypothetical protein	-
AB8E26_RS12530 (AB8E26_12540)	-	2774073..2774750 (+)	678	WP_017356179.1	response regulator transcription factor	-
AB8E26_RS12535 (AB8E26_12545)	-	2774713..2776080 (+)	1368	WP_369968045.1	sensor histidine kinase	-
AB8E26_RS12540 (AB8E26_12550)	coaE	2776177..2776794 (-)	618	WP_369968046.1	dephospho-CoA kinase	-
AB8E26_RS12545 (AB8E26_12555)	-	2776805..2777668 (-)	864	WP_128095489.1	A24 family peptidase	-
AB8E26_RS12550 (AB8E26_12560)	pilC	2777676..2778935 (-)	1260	WP_369968047.1	type II secretion system F family protein	Machinery gene
AB8E26_RS12555 (AB8E26_12565)	pilA2	2779293..2779727 (+)	435	WP_369970414.1	pilin	Machinery gene
AB8E26_RS12560 (AB8E26_12570)	-	2779798..2781009 (+)	1212	WP_369968048.1	isoprenylcysteine carboxylmethyltransferase family protein	-
AB8E26_RS12565 (AB8E26_12575)	-	2780996..2781922 (+)	927	WP_369968049.1	serine hydrolase	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 14392.67 Da
• Isoelectric Point: 8.4715

>NTDB_id=1032577 AB8E26_RS12555 WP_369970414.1 2779293..2779727(+) (pilA2) [Stenotrophomonas rhizophila strain busan1-1]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTTRAKVSEVVVMAAPAKLAVSETSSSLGGLATVTAANAGYTFPGATK
YVSGITVADGGIVTAASSVPGAAGNIVLTPKDVGNGQLTWTCSTTIDKKFVPAECRGAAAATGG

Nucleotide

• Length: 435 bp

>NTDB_id=1032577 AB8E26_RS12555 WP_369970414.1 2779293..2779727(+) (pilA2) [Stenotrophomonas rhizophila strain busan1-1]
ATGAAGAAGCAGCAGGGCTTTACCCTTATCGAACTGATGATCGTTGTCGCGATCATCGCCATCCTGGCCGCCATCGCACT
GCCGGCTTACCAGGACTACACCACCCGCGCGAAGGTGTCGGAAGTGGTCGTGATGGCTGCGCCGGCCAAGCTGGCTGTTT
CGGAGACGTCTTCGTCGCTGGGCGGCCTGGCCACGGTGACCGCTGCCAACGCTGGTTACACCTTCCCGGGCGCCACCAAG
TACGTGTCGGGCATCACCGTTGCTGATGGCGGCATCGTCACTGCGGCTTCGAGCGTTCCCGGCGCCGCCGGCAACATCGT
GCTGACCCCGAAGGATGTCGGTAACGGTCAGCTGACCTGGACCTGCTCCACCACCATCGACAAGAAGTTCGTCCCGGCAG
AATGCCGTGGCGCTGCTGCTGCGACGGGCGGCTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (35-136)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila str. Paris	51.852	93.75	0.486
comP	Acinetobacter baylyi ADP1	46.622	100	0.479
pilA2	Legionella pneumophila strain ERS1305867	51.111	93.75	0.479
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	34.595	100	0.444
pilE	Neisseria gonorrhoeae strain FA1090	38.182	100	0.438
pilA	Ralstonia pseudosolanacearum GMI1000	37.805	100	0.431
pilE	Neisseria gonorrhoeae MS11	37.037	100	0.417
pilA/pilAI	Pseudomonas stutzeri DSM 10701	41.912	94.444	0.396
pilA	Glaesserella parasuis strain SC1401	37.013	100	0.396
pilA	Haemophilus influenzae Rd KW20	39.041	100	0.396
pilA/pilA1	Eikenella corrodens VA1	37.333	100	0.389
pilA	Pseudomonas aeruginosa PAK	35.484	100	0.382
pilA	Haemophilus influenzae 86-028NP	37.671	100	0.382
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.259	93.75	0.368