Detailed information NTG1006463

Bioinformatically predicted

Overview

• Name: comEC
• Type: Machinery gene
• Locus tag: ABKP85_RS09820
• Genome accession: NZ_CP157379
• Coordinates: 1945938..1946231 (-)
• Length: 97 a.a.
• NCBI ID: WP_406846209.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain NZ3900
• Function: ssDNA transport into the cell (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1940938..1951231

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABKP85_RS09790 (ABKP85_09770)	atpA	1940979..1942481 (-)	1503	WP_011835691.1	F0F1 ATP synthase subunit alpha	-
ABKP85_RS09795 (ABKP85_09775)	-	1942670..1943197 (-)	528	WP_011835692.1	F0F1 ATP synthase subunit delta	-
ABKP85_RS09800 (ABKP85_09780)	atpF	1943199..1943705 (-)	507	WP_010906128.1	F0F1 ATP synthase subunit B	-
ABKP85_RS09805 (ABKP85_09785)	atpB	1943720..1944433 (-)	714	WP_004255255.1	F0F1 ATP synthase subunit A	-
ABKP85_RS09810 (ABKP85_09790)	-	1944480..1944695 (-)	216	WP_004255250.1	F0F1 ATP synthase subunit C	-
ABKP85_RS09815 (ABKP85_09795)	-	1944878..1945654 (-)	777	WP_011835694.1	alpha/beta hydrolase family protein	-
ABKP85_RS09820	comEC	1945938..1946231 (-)	294	WP_406846209.1	ComEC/Rec2 family competence protein	Machinery gene
ABKP85_RS09825	comEC	1946279..1946731 (-)	453	WP_406846214.1	ComEC/Rec2 family competence protein	Machinery gene
ABKP85_RS09830	-	1946873..1947121 (-)	249	Protein_1918	DNA internalization-related competence protein ComEC/Rec2	-
ABKP85_RS09835	comEC	1947115..1947999 (-)	885	WP_406846210.1	ComEC/Rec2 family competence protein	Machinery gene
ABKP85_RS09840 (ABKP85_09805)	comEA	1948127..1948783 (-)	657	WP_014735120.1	helix-hairpin-helix domain-containing protein	Machinery gene
ABKP85_RS09845 (ABKP85_09810)	-	1948841..1950202 (-)	1362	WP_011835696.1	ABC transporter permease	-
ABKP85_RS09850 (ABKP85_09815)	-	1950199..1951131 (-)	933	WP_011835697.1	ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 11077.75 Da
• Isoelectric Point: 10.3029

>NTDB_id=1006463 ABKP85_RS09820 WP_406846209.1 1945938..1946231(-) (comEC) [Lactococcus cremoris strain NZ3900]
MEQEGEKKLLQNYPKLQVDVLKVGHHGSKTSSSPEFIKEIHPKLALISVGKANRYGHPNQETLETLAKYQVKTLRTDQKG
AIKLTEVNQQWQIKTVR

Nucleotide

• Length: 294 bp

>NTDB_id=1006463 ABKP85_RS09820 WP_406846209.1 1945938..1946231(-) (comEC) [Lactococcus cremoris strain NZ3900]
TTGGAACAAGAAGGAGAAAAAAAGCTTCTACAAAATTATCCCAAATTACAGGTAGATGTGTTAAAAGTGGGGCATCATGG
CAGTAAAACAAGTTCAAGTCCGGAATTCATCAAAGAGATACATCCTAAACTTGCACTAATCTCGGTTGGAAAAGCTAATC
GCTATGGTCATCCCAATCAAGAAACTTTAGAAACCTTAGCCAAATATCAGGTAAAGACACTCAGAACTGACCAAAAAGGG
GCAATAAAATTAACAGAAGTAAATCAGCAATGGCAAATCAAAACAGTTAGATAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comEC	Lactococcus lactis subsp. cremoris KW2	98.969	100	0.99
comEC/celB	Streptococcus mitis NCTC 12261	52.083	98.969	0.515
comEC/celB	Streptococcus mitis SK321	51.546	100	0.515
comEC/celB	Streptococcus pneumoniae TIGR4	50.515	100	0.505
comEC/celB	Streptococcus pneumoniae Rx1	50.515	100	0.505
comEC/celB	Streptococcus pneumoniae D39	50.515	100	0.505
comEC/celB	Streptococcus pneumoniae R6	50.515	100	0.505
comEC	Latilactobacillus sakei subsp. sakei 23K	57.317	84.536	0.485
comA/comEC	Acinetobacter baylyi ADP1	49.438	91.753	0.454
comEC	Bacillus subtilis subsp. subtilis str. 168	50.602	85.567	0.433
comEC	Staphylococcus aureus MW2	45.122	84.536	0.381
comEC	Staphylococcus aureus N315	44.578	85.567	0.381
comEC	Legionella pneumophila strain ERS1305867	40.217	94.845	0.381
comEC	Vibrio cholerae strain A1552	45	82.474	0.371
comA/comEC	Acinetobacter baumannii strain A118	41.379	89.691	0.371
comA/comEC	Acinetobacter baumannii D1279779	41.379	89.691	0.371
comEC	Legionella pneumophila strain Lp02	41.379	89.691	0.371
comEC	Vibrio parahaemolyticus RIMD 2210633	36.082	100	0.361