Detailed information
Overview
| Name | pilE | Type | Machinery gene |
| Locus tag | ABFU61_RS17210 | Genome accession | NZ_CP155985 |
| Coordinates | 3917488..3917928 (-) | Length | 146 a.a. |
| NCBI ID | WP_011038214.1 | Uniprot ID | Q8P671 |
| Organism | Xanthomonas campestris pv. campestris strain LMG 08106 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3884556..3941808 | 3917488..3917928 | within | 0 |
Gene organization within MGE regions
Location: 3884556..3941808
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU61_RS17080 (ABFU61_17080) | - | 3885302..3886174 (-) | 873 | WP_050911334.1 | XAC2610-related protein | - |
| ABFU61_RS17085 (ABFU61_17085) | - | 3886198..3886671 (-) | 474 | WP_012437623.1 | DUF3574 domain-containing protein | - |
| ABFU61_RS17090 (ABFU61_17090) | - | 3886876..3889311 (+) | 2436 | WP_011038194.1 | TonB-dependent siderophore receptor | - |
| ABFU61_RS17095 (ABFU61_17095) | otsB | 3890033..3890791 (+) | 759 | WP_068573934.1 | trehalose-phosphatase | - |
| ABFU61_RS17100 (ABFU61_17100) | - | 3890841..3892619 (+) | 1779 | WP_040940809.1 | glycoside hydrolase family 15 protein | - |
| ABFU61_RS17105 (ABFU61_17105) | otsA | 3892616..3893983 (+) | 1368 | WP_011038197.1 | alpha,alpha-trehalose-phosphate synthase (UDP-forming) | - |
| ABFU61_RS17110 (ABFU61_17110) | - | 3894438..3894602 (-) | 165 | WP_301988105.1 | hypothetical protein | - |
| ABFU61_RS17115 (ABFU61_17115) | - | 3894982..3897417 (+) | 2436 | WP_029628877.1 | glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase | - |
| ABFU61_RS17120 (ABFU61_17120) | - | 3897948..3899766 (+) | 1819 | Protein_3307 | methyl-accepting chemotaxis protein | - |
| ABFU61_RS17125 (ABFU61_17125) | - | 3900402..3900821 (-) | 420 | WP_012437616.1 | thiol-disulfide oxidoreductase DCC family protein | - |
| ABFU61_RS17130 (ABFU61_17130) | - | 3900808..3901305 (-) | 498 | WP_050911332.1 | DUF4166 domain-containing protein | - |
| ABFU61_RS17135 (ABFU61_17135) | pgeF | 3901326..3902126 (-) | 801 | WP_050911331.1 | peptidoglycan editing factor PgeF | - |
| ABFU61_RS17140 (ABFU61_17140) | rluD | 3902128..3903123 (-) | 996 | WP_057671673.1 | 23S rRNA pseudouridine(1911/1915/1917) synthase RluD | - |
| ABFU61_RS17145 (ABFU61_17145) | - | 3903246..3904127 (+) | 882 | WP_011038204.1 | outer membrane protein assembly factor BamD | - |
| ABFU61_RS17150 (ABFU61_17150) | - | 3904579..3905565 (+) | 987 | WP_057671671.1 | hypothetical protein | - |
| ABFU61_RS17155 (ABFU61_17155) | - | 3905559..3907214 (-) | 1656 | WP_057671669.1 | NAD+ synthase | - |
| ABFU61_RS17160 (ABFU61_17160) | - | 3907214..3907516 (-) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ABFU61_RS17165 (ABFU61_17165) | - | 3907520..3907930 (-) | 411 | WP_029628876.1 | CopG family ribbon-helix-helix protein | - |
| ABFU61_RS17170 (ABFU61_17170) | sucD | 3908034..3908909 (-) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU61_RS17175 (ABFU61_17175) | sucC | 3908934..3910103 (-) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU61_RS17180 (ABFU61_17180) | - | 3910337..3911947 (+) | 1611 | WP_011038210.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU61_RS17185 (ABFU61_17185) | pilR | 3912156..3913550 (+) | 1395 | WP_043877723.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU61_RS17195 (ABFU61_17195) | - | 3913848..3914950 (+) | 1103 | Protein_3321 | IS3-like element IS1404 family transposase | - |
| ABFU61_RS17200 (ABFU61_17200) | pilB | 3915176..3916909 (-) | 1734 | WP_011038212.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU61_RS17205 (ABFU61_17205) | - | 3916974..3917375 (-) | 402 | WP_194734302.1 | pilin | - |
| ABFU61_RS17210 (ABFU61_17210) | pilE | 3917488..3917928 (-) | 441 | WP_011038214.1 | pilin | Machinery gene |
| ABFU61_RS17215 (ABFU61_17215) | pilC | 3918255..3919511 (+) | 1257 | WP_011038215.1 | type II secretion system F family protein | Machinery gene |
| ABFU61_RS17220 (ABFU61_17220) | - | 3919518..3920381 (+) | 864 | WP_011038216.1 | A24 family peptidase | - |
| ABFU61_RS17225 (ABFU61_17225) | coaE | 3920395..3921018 (+) | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
| ABFU61_RS17230 (ABFU61_17230) | - | 3921550..3921951 (+) | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
| ABFU61_RS17235 (ABFU61_17235) | - | 3922026..3922316 (+) | 291 | WP_011038219.1 | DUF1778 domain-containing protein | - |
| ABFU61_RS17240 (ABFU61_17240) | - | 3922313..3922804 (+) | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | - |
| ABFU61_RS17245 (ABFU61_17245) | - | 3922947..3924281 (-) | 1335 | WP_057671653.1 | HAMP domain-containing sensor histidine kinase | - |
| ABFU61_RS17250 (ABFU61_17250) | - | 3924274..3924951 (-) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU61_RS17255 (ABFU61_17255) | rimK | 3925601..3926476 (-) | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU61_RS17260 (ABFU61_17260) | glgX | 3926969..3929098 (+) | 2130 | WP_057671651.1 | glycogen debranching protein GlgX | - |
| ABFU61_RS17265 (ABFU61_17265) | - | 3929633..3930025 (-) | 393 | WP_012437593.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU61_RS17270 (ABFU61_17270) | - | 3930116..3930511 (-) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU61_RS17275 (ABFU61_17275) | - | 3930696..3930842 (-) | 147 | WP_040940792.1 | hypothetical protein | - |
| ABFU61_RS17280 (ABFU61_17280) | - | 3930906..3931136 (+) | 231 | WP_157382680.1 | hypothetical protein | - |
| ABFU61_RS17285 (ABFU61_17285) | - | 3931435..3931785 (-) | 351 | WP_225443878.1 | hypothetical protein | - |
| ABFU61_RS17290 (ABFU61_17290) | - | 3932511..3932852 (+) | 342 | WP_081020748.1 | hypothetical protein | - |
| ABFU61_RS17295 (ABFU61_17295) | - | 3932918..3933199 (+) | 282 | WP_011348355.1 | DUF6516 family protein | - |
| ABFU61_RS17300 (ABFU61_17300) | - | 3933207..3933575 (+) | 369 | WP_225443877.1 | transcriptional regulator | - |
| ABFU61_RS17305 (ABFU61_17305) | - | 3933648..3935243 (-) | 1596 | WP_192012501.1 | MobA/MobL family protein | - |
| ABFU61_RS17310 (ABFU61_17310) | - | 3935510..3935764 (+) | 255 | WP_057671639.1 | hypothetical protein | - |
| ABFU61_RS17315 (ABFU61_17315) | - | 3935792..3936217 (-) | 426 | Protein_3345 | XVIPCD domain-containing protein | - |
| ABFU61_RS17320 (ABFU61_17320) | - | 3937206..3937361 (-) | 156 | WP_186009287.1 | hypothetical protein | - |
| ABFU61_RS17325 (ABFU61_17325) | - | 3937995..3938186 (-) | 192 | WP_221261829.1 | hypothetical protein | - |
| ABFU61_RS17330 (ABFU61_17330) | - | 3938257..3938736 (-) | 480 | WP_075286085.1 | RadC family protein | - |
Sequence
Protein
Download Length: 146 a.a. Molecular weight: 14797.93 Da Isoelectric Point: 9.0090
>NTDB_id=1000749 ABFU61_RS17210 WP_011038214.1 3917488..3917928(-) (pilE) [Xanthomonas campestris pv. campestris strain LMG 08106]
MKKQNGFTLIELMIVVAIIAILAAIALPAYQDYLARSQVSEGLSLASGAKTAVAETYANTGAFPATNAAAGLEAAANIKG
KYVTSVTVGAGGIITAAFNTANAKLSGKNLVLTPTDNNGSISWGCTNGTTIDQKYLPTSCRTAAAP
MKKQNGFTLIELMIVVAIIAILAAIALPAYQDYLARSQVSEGLSLASGAKTAVAETYANTGAFPATNAAAGLEAAANIKG
KYVTSVTVGAGGIITAAFNTANAKLSGKNLVLTPTDNNGSISWGCTNGTTIDQKYLPTSCRTAAAP
Nucleotide
Download Length: 441 bp
>NTDB_id=1000749 ABFU61_RS17210 WP_011038214.1 3917488..3917928(-) (pilE) [Xanthomonas campestris pv. campestris strain LMG 08106]
ATGAAAAAGCAAAATGGTTTTACACTGATCGAACTCATGATCGTCGTTGCGATCATCGCTATTCTGGCCGCTATCGCTTT
GCCGGCGTACCAGGATTACCTCGCTCGTTCGCAGGTTTCGGAAGGCTTGTCTTTGGCGTCGGGTGCAAAGACAGCTGTCG
CTGAAACTTATGCTAACACCGGTGCCTTCCCGGCGACCAATGCCGCCGCTGGCCTTGAGGCTGCTGCGAACATCAAGGGT
AAGTACGTTACGTCTGTGACGGTGGGGGCGGGTGGGATCATCACCGCGGCATTCAATACTGCTAATGCAAAGTTGAGTGG
CAAGAATCTGGTCCTGACCCCGACTGACAATAACGGTTCGATCAGCTGGGGGTGCACCAACGGCACCACGATTGATCAGA
AGTATCTGCCGACCTCTTGCCGCACTGCGGCGGCTCCGTAA
ATGAAAAAGCAAAATGGTTTTACACTGATCGAACTCATGATCGTCGTTGCGATCATCGCTATTCTGGCCGCTATCGCTTT
GCCGGCGTACCAGGATTACCTCGCTCGTTCGCAGGTTTCGGAAGGCTTGTCTTTGGCGTCGGGTGCAAAGACAGCTGTCG
CTGAAACTTATGCTAACACCGGTGCCTTCCCGGCGACCAATGCCGCCGCTGGCCTTGAGGCTGCTGCGAACATCAAGGGT
AAGTACGTTACGTCTGTGACGGTGGGGGCGGGTGGGATCATCACCGCGGCATTCAATACTGCTAATGCAAAGTTGAGTGG
CAAGAATCTGGTCCTGACCCCGACTGACAATAACGGTTCGATCAGCTGGGGGTGCACCAACGGCACCACGATTGATCAGA
AGTATCTGCCGACCTCTTGCCGCACTGCGGCGGCTCCGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilE | Neisseria gonorrhoeae MS11 |
46.875 |
100 |
0.514 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
46.541 |
100 |
0.507 |
| pilA2 | Legionella pneumophila str. Paris |
52.857 |
95.89 |
0.507 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
52.143 |
95.89 |
0.5 |
| pilA/pilA1 | Eikenella corrodens VA1 |
46.452 |
100 |
0.493 |
| comP | Acinetobacter baylyi ADP1 |
48 |
100 |
0.493 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
37.5 |
100 |
0.473 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
40.244 |
100 |
0.452 |
| pilA | Acinetobacter baumannii strain A118 |
41.333 |
100 |
0.425 |
| pilA | Pseudomonas aeruginosa PAK |
40.789 |
100 |
0.425 |
| pilA | Vibrio campbellii strain DS40M4 |
40.268 |
100 |
0.411 |
| pilA | Vibrio cholerae C6706 |
38.411 |
100 |
0.397 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
38.411 |
100 |
0.397 |
| pilA | Vibrio cholerae strain A1552 |
38.411 |
100 |
0.397 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
40.288 |
95.205 |
0.384 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
42.4 |
85.616 |
0.363 |