Detailed information
Overview
| Name | pilA/pilAI | Type | Machinery gene |
| Locus tag | ABFU34_RS05165 | Genome accession | NZ_CP155966 |
| Coordinates | 1233926..1234333 (+) | Length | 135 a.a. |
| NCBI ID | WP_228442818.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. raphani strain BXC#143 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1194759..1252166 | 1233926..1234333 | within | 0 |
Gene organization within MGE regions
Location: 1194759..1252166
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU34_RS04985 (ABFU34_04975) | - | 1196235..1197515 (+) | 1281 | WP_228442796.1 | SidA/IucD/PvdA family monooxygenase | - |
| ABFU34_RS04990 (ABFU34_04980) | - | 1197569..1197820 (+) | 252 | WP_228442797.1 | hypothetical protein | - |
| ABFU34_RS04995 (ABFU34_04985) | - | 1198239..1198616 (-) | 378 | WP_228442798.1 | hypothetical protein | - |
| ABFU34_RS05000 (ABFU34_04990) | - | 1198613..1198927 (-) | 315 | WP_228442799.1 | hypothetical protein | - |
| ABFU34_RS05005 (ABFU34_04995) | - | 1198984..1199746 (-) | 763 | Protein_970 | hypothetical protein | - |
| ABFU34_RS05010 (ABFU34_05000) | - | 1199908..1200189 (+) | 282 | WP_373046018.1 | helix-turn-helix domain-containing protein | - |
| ABFU34_RS05015 (ABFU34_05005) | dndC | 1200359..1201489 (+) | 1131 | WP_228442802.1 | DNA phosphorothioation system sulfurtransferase DndC | - |
| ABFU34_RS05020 (ABFU34_05010) | - | 1201511..1201726 (+) | 216 | WP_082346685.1 | DNA modification system-associated small protein | - |
| ABFU34_RS05025 (ABFU34_05015) | dndD | 1201716..1203794 (+) | 2079 | WP_228442803.1 | DNA sulfur modification protein DndD | - |
| ABFU34_RS05030 (ABFU34_05020) | - | 1203796..1205325 (+) | 1530 | WP_228442804.1 | ATP-binding protein | - |
| ABFU34_RS05035 (ABFU34_05025) | - | 1205358..1205693 (+) | 336 | WP_228442805.1 | hypothetical protein | - |
| ABFU34_RS05040 (ABFU34_05030) | - | 1205877..1207277 (-) | 1401 | WP_228442806.1 | site-specific integrase | - |
| ABFU34_RS05045 (ABFU34_05035) | - | 1207825..1208049 (+) | 225 | WP_053051249.1 | hypothetical protein | - |
| ABFU34_RS05050 (ABFU34_05040) | - | 1208446..1208926 (+) | 481 | Protein_979 | RadC family protein | - |
| ABFU34_RS05055 (ABFU34_05045) | - | 1209176..1209835 (+) | 660 | WP_228442836.1 | DUF1629 domain-containing protein | - |
| ABFU34_RS05060 (ABFU34_05050) | - | 1209872..1213864 (+) | 3993 | WP_228442807.1 | hypothetical protein | - |
| ABFU34_RS05065 (ABFU34_05055) | - | 1213906..1214556 (+) | 651 | WP_228442808.1 | hypothetical protein | - |
| ABFU34_RS05070 (ABFU34_05060) | - | 1214925..1215464 (+) | 540 | WP_228442809.1 | hypothetical protein | - |
| ABFU34_RS05075 (ABFU34_05065) | - | 1215464..1216705 (+) | 1242 | WP_228442810.1 | DGQHR domain-containing protein | - |
| ABFU34_RS05080 (ABFU34_05070) | - | 1216733..1217863 (+) | 1131 | WP_228442811.1 | ParB N-terminal domain-containing protein | - |
| ABFU34_RS05085 (ABFU34_05075) | - | 1218132..1218461 (-) | 330 | WP_228442812.1 | hypothetical protein | - |
| ABFU34_RS05090 (ABFU34_05080) | - | 1218728..1220323 (+) | 1596 | WP_228442813.1 | MobA/MobL family protein | - |
| ABFU34_RS05095 (ABFU34_05085) | - | 1220376..1220717 (-) | 342 | WP_228442814.1 | hypothetical protein | - |
| ABFU34_RS05100 (ABFU34_05090) | - | 1221539..1221793 (+) | 255 | WP_228442815.1 | hypothetical protein | - |
| ABFU34_RS05105 (ABFU34_05095) | - | 1222083..1222313 (-) | 231 | WP_181920809.1 | hypothetical protein | - |
| ABFU34_RS05110 (ABFU34_05100) | - | 1222377..1222523 (+) | 147 | WP_076054137.1 | hypothetical protein | - |
| ABFU34_RS05115 (ABFU34_05105) | - | 1222707..1223102 (+) | 396 | WP_042594933.1 | hypothetical protein | - |
| ABFU34_RS05120 (ABFU34_05110) | - | 1223193..1223585 (+) | 393 | WP_011038224.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU34_RS05125 (ABFU34_05115) | glgX | 1224111..1226240 (-) | 2130 | WP_228442816.1 | glycogen debranching protein GlgX | - |
| ABFU34_RS05130 (ABFU34_05120) | rimK | 1226733..1227608 (+) | 876 | WP_116921527.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU34_RS05135 (ABFU34_05125) | - | 1228258..1228935 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU34_RS05140 (ABFU34_05130) | - | 1228928..1230258 (+) | 1331 | Protein_997 | sensor histidine kinase | - |
| ABFU34_RS05145 (ABFU34_05135) | - | 1230357..1230612 (-) | 256 | Protein_998 | SymE family type I addiction module toxin | - |
| ABFU34_RS05150 (ABFU34_05140) | coaE | 1230806..1231429 (-) | 624 | WP_225042504.1 | dephospho-CoA kinase | - |
| ABFU34_RS05155 (ABFU34_05145) | - | 1231443..1232306 (-) | 864 | WP_040940797.1 | A24 family peptidase | - |
| ABFU34_RS05160 (ABFU34_05150) | pilC | 1232313..1233575 (-) | 1263 | WP_228442817.1 | type II secretion system F family protein | Machinery gene |
| ABFU34_RS05165 (ABFU34_05155) | pilA/pilAI | 1233926..1234333 (+) | 408 | WP_228442818.1 | pilin | Machinery gene |
| ABFU34_RS05170 (ABFU34_05160) | - | 1234466..1234852 (+) | 387 | WP_373046337.1 | pilin | - |
| ABFU34_RS05175 (ABFU34_05165) | - | 1234911..1236731 (+) | 1821 | WP_323539564.1 | hypothetical protein | - |
| ABFU34_RS05180 (ABFU34_05170) | - | 1236840..1237598 (+) | 759 | WP_228442820.1 | class I SAM-dependent methyltransferase | - |
| ABFU34_RS05185 (ABFU34_05175) | - | 1237696..1238781 (+) | 1086 | WP_407463960.1 | glycosyltransferase family 9 protein | - |
| ABFU34_RS05190 (ABFU34_05180) | - | 1238784..1239626 (-) | 843 | WP_228442822.1 | glycosyltransferase | - |
| ABFU34_RS05195 (ABFU34_05185) | - | 1239620..1240792 (-) | 1173 | WP_228442823.1 | glycosyltransferase | - |
| ABFU34_RS05200 (ABFU34_05190) | - | 1240777..1241640 (-) | 864 | WP_228442824.1 | glycosyltransferase | - |
| ABFU34_RS05205 (ABFU34_05195) | - | 1241690..1242541 (-) | 852 | WP_108133901.1 | glycosyltransferase family 2 protein | - |
| ABFU34_RS05210 (ABFU34_05200) | pilB | 1242697..1244433 (+) | 1737 | WP_040940802.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU34_RS05215 (ABFU34_05205) | pilR | 1245818..1247212 (-) | 1395 | WP_012437607.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU34_RS05220 (ABFU34_05210) | - | 1247421..1249043 (-) | 1623 | WP_407470555.1 | sensor histidine kinase | - |
| ABFU34_RS05225 (ABFU34_05215) | sucC | 1249277..1250446 (+) | 1170 | WP_011038209.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU34_RS05230 (ABFU34_05220) | sucD | 1250471..1251346 (+) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU34_RS05235 (ABFU34_05225) | - | 1251483..1251860 (+) | 378 | WP_019237352.1 | CopG family ribbon-helix-helix protein | - |
| ABFU34_RS05240 (ABFU34_05230) | - | 1251864..1252166 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 135 a.a. Molecular weight: 13751.97 Da Isoelectric Point: 8.8610
>NTDB_id=1000406 ABFU34_RS05165 WP_228442818.1 1233926..1234333(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain BXC#143]
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKAQATAGLAEITPGKTQFEVLVNEGSTPTLAGIGLNSPTSRCSSV
VVAATSITCTLRGNASKITGKTLALSRDATTGVWTCQTGGSGGGLDAKYKPAGCS
MKKQQGFTLIELMIVVAIIAILAAIALPMYQDYVAKAQATAGLAEITPGKTQFEVLVNEGSTPTLAGIGLNSPTSRCSSV
VVAATSITCTLRGNASKITGKTLALSRDATTGVWTCQTGGSGGGLDAKYKPAGCS
Nucleotide
Download Length: 408 bp
>NTDB_id=1000406 ABFU34_RS05165 WP_228442818.1 1233926..1234333(+) (pilA/pilAI) [Xanthomonas campestris pv. raphani strain BXC#143]
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGGCACAGGCGACTGCTGGCCTGGCCGAAATCACCCCCGGCAAGACGCAGTTCG
AAGTTCTTGTGAATGAAGGCTCTACCCCTACCCTGGCTGGAATTGGTTTGAACAGCCCAACCTCGCGTTGCAGCAGCGTT
GTAGTAGCCGCAACCAGCATCACTTGCACTTTGAGAGGAAATGCATCCAAGATTACTGGCAAAACCCTTGCTCTTAGTCG
GGACGCTACAACAGGTGTTTGGACCTGCCAAACTGGCGGTTCTGGCGGCGGCTTGGATGCCAAGTACAAGCCCGCCGGTT
GCAGCTGA
ATGAAGAAGCAGCAAGGCTTTACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGCCATCCTGGCCGCCATCGCGCT
GCCGATGTATCAGGACTATGTTGCCAAGGCACAGGCGACTGCTGGCCTGGCCGAAATCACCCCCGGCAAGACGCAGTTCG
AAGTTCTTGTGAATGAAGGCTCTACCCCTACCCTGGCTGGAATTGGTTTGAACAGCCCAACCTCGCGTTGCAGCAGCGTT
GTAGTAGCCGCAACCAGCATCACTTGCACTTTGAGAGGAAATGCATCCAAGATTACTGGCAAAACCCTTGCTCTTAGTCG
GGACGCTACAACAGGTGTTTGGACCTGCCAAACTGGCGGTTCTGGCGGCGGCTTGGATGCCAAGTACAAGCCCGCCGGTT
GCAGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
54.286 |
100 |
0.563 |
| pilA | Acinetobacter baumannii strain A118 |
46.528 |
100 |
0.496 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
46.377 |
100 |
0.474 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
44.286 |
100 |
0.459 |
| pilA2 | Legionella pneumophila str. Paris |
43.571 |
100 |
0.452 |
| pilA | Pseudomonas aeruginosa PAK |
38.065 |
100 |
0.437 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
35.758 |
100 |
0.437 |
| pilA | Vibrio cholerae strain A1552 |
40.136 |
100 |
0.437 |
| pilA | Vibrio cholerae C6706 |
40.136 |
100 |
0.437 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
40.136 |
100 |
0.437 |
| pilA/pilA1 | Eikenella corrodens VA1 |
36.667 |
100 |
0.407 |
| pilE | Neisseria gonorrhoeae MS11 |
35.484 |
100 |
0.407 |
| comP | Acinetobacter baylyi ADP1 |
36.184 |
100 |
0.407 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
44.628 |
89.63 |
0.4 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
35.294 |
100 |
0.4 |