Detailed information
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | ABFU69_RS05305 | Genome accession | NZ_CP155936 |
| Coordinates | 1242709..1243122 (+) | Length | 137 a.a. |
| NCBI ID | WP_012437602.1 | Uniprot ID | - |
| Organism | Xanthomonas campestris pv. campestris strain Xcc-G | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1196862..1255509 | 1242709..1243122 | within | 0 |
Gene organization within MGE regions
Location: 1196862..1255509
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFU69_RS05055 (ABFU69_05055) | - | 1198466..1198894 (+) | 429 | WP_145998822.1 | hypothetical protein | - |
| ABFU69_RS05060 (ABFU69_05060) | - | 1199279..1200067 (-) | 789 | WP_145998823.1 | hypothetical protein | - |
| ABFU69_RS05065 (ABFU69_05065) | - | 1200141..1201034 (-) | 894 | WP_145998824.1 | hypothetical protein | - |
| ABFU69_RS05070 (ABFU69_05070) | - | 1201200..1201580 (-) | 381 | WP_172973787.1 | hypothetical protein | - |
| ABFU69_RS05075 (ABFU69_05075) | - | 1201577..1201891 (-) | 315 | WP_100666315.1 | hypothetical protein | - |
| ABFU69_RS05080 (ABFU69_05080) | - | 1201941..1202702 (-) | 762 | WP_100666316.1 | hypothetical protein | - |
| ABFU69_RS05085 (ABFU69_05085) | - | 1202880..1203179 (+) | 300 | WP_230428394.1 | helix-turn-helix domain-containing protein | - |
| ABFU69_RS05090 (ABFU69_05090) | - | 1203191..1203679 (+) | 489 | WP_230431642.1 | ADP-dependent glucokinase/phosphofructokinase | - |
| ABFU69_RS05095 (ABFU69_05095) | - | 1203684..1204136 (-) | 453 | WP_145998825.1 | hypothetical protein | - |
| ABFU69_RS05100 (ABFU69_05100) | - | 1204339..1205739 (-) | 1401 | WP_100666320.1 | site-specific integrase | - |
| ABFU69_RS05105 (ABFU69_05105) | - | 1206349..1206864 (-) | 516 | WP_100666321.1 | hypothetical protein | - |
| ABFU69_RS05110 (ABFU69_05110) | - | 1206953..1207438 (+) | 486 | WP_145998826.1 | hypothetical protein | - |
| ABFU69_RS05115 (ABFU69_05115) | - | 1207571..1209055 (-) | 1485 | WP_100666322.1 | hypothetical protein | - |
| ABFU69_RS05120 (ABFU69_05120) | - | 1209135..1210100 (-) | 966 | WP_322633703.1 | hypothetical protein | - |
| ABFU69_RS05125 (ABFU69_05125) | - | 1210490..1210750 (+) | 261 | WP_145998828.1 | hypothetical protein | - |
| ABFU69_RS05130 (ABFU69_05130) | - | 1210737..1211234 (-) | 498 | WP_152091502.1 | hypothetical protein | - |
| ABFU69_RS05135 (ABFU69_05135) | - | 1211344..1211874 (-) | 531 | WP_152091503.1 | hypothetical protein | - |
| ABFU69_RS05140 (ABFU69_05140) | - | 1211909..1212721 (-) | 813 | WP_152091504.1 | AbiJ-NTD4 domain-containing protein | - |
| ABFU69_RS05145 (ABFU69_05145) | - | 1212718..1213026 (-) | 309 | WP_152091505.1 | hypothetical protein | - |
| ABFU69_RS05150 (ABFU69_05150) | - | 1213237..1213716 (+) | 480 | WP_152091506.1 | RadC family protein | - |
| ABFU69_RS05155 (ABFU69_05155) | - | 1213785..1213961 (+) | 177 | WP_172973789.1 | hypothetical protein | - |
| ABFU69_RS05160 (ABFU69_05160) | - | 1214181..1214822 (+) | 642 | WP_152091507.1 | DUF1629 domain-containing protein | - |
| ABFU69_RS05165 (ABFU69_05165) | - | 1214858..1217443 (+) | 2586 | WP_218065346.1 | XVIPCD domain-containing protein | - |
| ABFU69_RS05170 (ABFU69_05170) | - | 1217846..1218484 (-) | 639 | WP_232053528.1 | hypothetical protein | - |
| ABFU69_RS05175 (ABFU69_05175) | - | 1218768..1219253 (-) | 486 | WP_152091557.1 | hypothetical protein | - |
| ABFU69_RS05180 (ABFU69_05180) | - | 1219351..1219890 (+) | 540 | WP_322708843.1 | hypothetical protein | - |
| ABFU69_RS05185 (ABFU69_05185) | - | 1219871..1220973 (+) | 1103 | Protein_1003 | IS3-like element IS1404 family transposase | - |
| ABFU69_RS05190 (ABFU69_05190) | - | 1221310..1221468 (+) | 159 | WP_172973790.1 | hypothetical protein | - |
| ABFU69_RS05195 (ABFU69_05195) | - | 1221585..1222340 (-) | 756 | WP_274503104.1 | hypothetical protein | - |
| ABFU69_RS05200 (ABFU69_05200) | - | 1222330..1222806 (-) | 477 | WP_152091510.1 | hypothetical protein | - |
| ABFU69_RS05205 (ABFU69_05205) | - | 1222967..1224901 (-) | 1935 | WP_197737888.1 | AAA family ATPase | - |
| ABFU69_RS05210 (ABFU69_05210) | - | 1225476..1225775 (-) | 300 | WP_100666201.1 | conjugal transfer protein TraD | - |
| ABFU69_RS05215 (ABFU69_05215) | - | 1226042..1227637 (+) | 1596 | WP_100666199.1 | MobA/MobL family protein | - |
| ABFU69_RS05220 (ABFU69_05220) | - | 1227690..1228031 (-) | 342 | WP_100666197.1 | hypothetical protein | - |
| ABFU69_RS05225 (ABFU69_05225) | - | 1228725..1229153 (+) | 429 | WP_012437589.1 | hypothetical protein | - |
| ABFU69_RS05230 (ABFU69_05230) | - | 1229396..1229626 (-) | 231 | WP_157382680.1 | hypothetical protein | - |
| ABFU69_RS05235 (ABFU69_05235) | - | 1229690..1229836 (+) | 147 | WP_040940792.1 | hypothetical protein | - |
| ABFU69_RS05240 (ABFU69_05240) | - | 1230021..1230416 (+) | 396 | WP_016945003.1 | hypothetical protein | - |
| ABFU69_RS05245 (ABFU69_05245) | - | 1230507..1230899 (+) | 393 | WP_012437593.1 | H-NS family nucleoid-associated regulatory protein | - |
| ABFU69_RS05250 (ABFU69_05250) | glgX | 1231433..1233562 (-) | 2130 | WP_016945001.1 | glycogen debranching protein GlgX | - |
| ABFU69_RS05255 (ABFU69_05255) | rimK | 1234056..1234931 (+) | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| ABFU69_RS05260 (ABFU69_05260) | - | 1235154..1235627 (+) | 474 | WP_012437597.1 | hypothetical protein | - |
| ABFU69_RS05265 (ABFU69_05265) | - | 1235658..1236335 (+) | 678 | WP_003490678.1 | response regulator transcription factor | - |
| ABFU69_RS05270 (ABFU69_05270) | - | 1236328..1237662 (+) | 1335 | WP_407472013.1 | sensor histidine kinase | - |
| ABFU69_RS05275 (ABFU69_05275) | - | 1237805..1238296 (-) | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | - |
| ABFU69_RS05280 (ABFU69_05280) | - | 1238293..1238583 (-) | 291 | WP_011038219.1 | DUF1778 domain-containing protein | - |
| ABFU69_RS05285 (ABFU69_05285) | - | 1238658..1239059 (-) | 402 | WP_012437599.1 | SymE family type I addiction module toxin | - |
| ABFU69_RS05290 (ABFU69_05290) | coaE | 1239591..1240214 (-) | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
| ABFU69_RS05295 (ABFU69_05295) | - | 1240228..1241091 (-) | 864 | WP_012437600.1 | A24 family peptidase | - |
| ABFU69_RS05300 (ABFU69_05300) | pilC | 1241098..1242357 (-) | 1260 | WP_012437601.1 | type II secretion system F family protein | Machinery gene |
| ABFU69_RS05305 (ABFU69_05305) | comP | 1242709..1243122 (+) | 414 | WP_012437602.1 | pilin | Machinery gene |
| ABFU69_RS05310 (ABFU69_05310) | - | 1243341..1244852 (+) | 1512 | WP_256729490.1 | phosphoethanolamine transferase | - |
| ABFU69_RS05315 (ABFU69_05315) | - | 1244863..1245492 (+) | 630 | WP_012437604.1 | hypothetical protein | - |
| ABFU69_RS05320 (ABFU69_05320) | - | 1245462..1246988 (+) | 1527 | WP_016944997.1 | membrane protein | - |
| ABFU69_RS05325 (ABFU69_05325) | pilB | 1247023..1248756 (+) | 1734 | WP_012437606.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ABFU69_RS05330 (ABFU69_05330) | pilR | 1249173..1250567 (-) | 1395 | WP_012437607.1 | sigma-54 dependent transcriptional regulator | Regulator |
| ABFU69_RS05335 (ABFU69_05335) | - | 1250776..1252386 (-) | 1611 | WP_012437608.1 | PAS domain-containing sensor histidine kinase | - |
| ABFU69_RS05340 (ABFU69_05340) | sucC | 1252620..1253789 (+) | 1170 | WP_012437609.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| ABFU69_RS05345 (ABFU69_05345) | sucD | 1253814..1254689 (+) | 876 | WP_011038208.1 | succinate--CoA ligase subunit alpha | - |
| ABFU69_RS05350 (ABFU69_05350) | - | 1254793..1255203 (+) | 411 | WP_029217117.1 | CopG family ribbon-helix-helix protein | - |
| ABFU69_RS05355 (ABFU69_05355) | - | 1255207..1255509 (+) | 303 | WP_011038207.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Sequence
Protein
Download Length: 137 a.a. Molecular weight: 14030.15 Da Isoelectric Point: 8.4883
>NTDB_id=999912 ABFU69_RS05305 WP_012437602.1 1242709..1243122(+) (comP) [Xanthomonas campestris pv. campestris strain Xcc-G]
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTIRSRVSEMAVLASGAKATIGENIANENAINANACRGVATFNTATTN
TASLACANGTVTVTGTAKAANVVLTYAPTLVDAGIRWTCSSASAAKYLPAECRGSGT
MKKQQGFTLIELMIVVAIIAILAAIALPAYQDYTIRSRVSEMAVLASGAKATIGENIANENAINANACRGVATFNTATTN
TASLACANGTVTVTGTAKAANVVLTYAPTLVDAGIRWTCSSASAAKYLPAECRGSGT
Nucleotide
Download Length: 414 bp
>NTDB_id=999912 ABFU69_RS05305 WP_012437602.1 1242709..1243122(+) (comP) [Xanthomonas campestris pv. campestris strain Xcc-G]
ATGAAGAAGCAGCAAGGCTTTACACTTATCGAACTGATGATCGTGGTCGCGATCATCGCTATCCTGGCCGCCATCGCGCT
GCCGGCTTATCAGGATTACACCATTCGCTCGCGTGTCTCTGAAATGGCTGTGCTCGCCTCCGGTGCCAAGGCGACAATTG
GTGAGAATATTGCCAATGAGAATGCGATTAATGCTAATGCGTGCCGCGGAGTTGCTACTTTTAACACCGCCACGACGAAC
ACTGCTTCCCTCGCGTGTGCCAACGGTACTGTCACTGTCACTGGTACGGCTAAGGCTGCGAACGTCGTTCTGACCTACGC
TCCGACCCTTGTGGACGCTGGCATCAGGTGGACCTGTTCGTCTGCCAGTGCGGCTAAGTACCTGCCGGCCGAATGCCGTG
GTTCGGGCACCTAA
ATGAAGAAGCAGCAAGGCTTTACACTTATCGAACTGATGATCGTGGTCGCGATCATCGCTATCCTGGCCGCCATCGCGCT
GCCGGCTTATCAGGATTACACCATTCGCTCGCGTGTCTCTGAAATGGCTGTGCTCGCCTCCGGTGCCAAGGCGACAATTG
GTGAGAATATTGCCAATGAGAATGCGATTAATGCTAATGCGTGCCGCGGAGTTGCTACTTTTAACACCGCCACGACGAAC
ACTGCTTCCCTCGCGTGTGCCAACGGTACTGTCACTGTCACTGGTACGGCTAAGGCTGCGAACGTCGTTCTGACCTACGC
TCCGACCCTTGTGGACGCTGGCATCAGGTGGACCTGTTCGTCTGCCAGTGCGGCTAAGTACCTGCCGGCCGAATGCCGTG
GTTCGGGCACCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comP | Acinetobacter baylyi ADP1 |
48.322 |
100 |
0.526 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
42.945 |
100 |
0.511 |
| pilA2 | Legionella pneumophila str. Paris |
50.746 |
97.81 |
0.496 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
50 |
97.81 |
0.489 |
| pilA/pilA1 | Eikenella corrodens VA1 |
39.073 |
100 |
0.431 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
37.662 |
100 |
0.423 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
41.007 |
100 |
0.416 |
| pilE | Neisseria gonorrhoeae MS11 |
36.774 |
100 |
0.416 |
| pilA | Vibrio parahaemolyticus RIMD 2210633 |
43.2 |
91.241 |
0.394 |
| pilA | Pseudomonas aeruginosa PAK |
35.333 |
100 |
0.387 |
| pilA | Acinetobacter baumannii strain A118 |
36.301 |
100 |
0.387 |
| pilA | Haemophilus influenzae Rd KW20 |
38.129 |
100 |
0.387 |
| pilA | Haemophilus influenzae 86-028NP |
38.129 |
100 |
0.387 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
37.41 |
100 |
0.38 |