Detailed information NTG0091168

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: L6419_RS00795
• Genome accession: NZ_AP025332
• Coordinates: 126848..127129 (+)
• Length: 93 a.a.
• NCBI ID: WP_024532254.1
• Uniprot ID: -
• Organism: Streptococcus ruminantium strain GUT-184
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 121848..132129

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L6419_RS00775 (GUT184_01220)	-	123431..123799 (+)	369	WP_155962601.1	DUF1033 family protein	-
L6419_RS00780 (GUT184_01230)	-	123837..124787 (-)	951	WP_237375492.1	S66 family peptidase	-
L6419_RS00785 (GUT184_01240)	comYA	124949..125899 (+)	951	WP_155962599.1	competence type IV pilus ATPase ComGA	Machinery gene
L6419_RS00790 (GUT184_01250)	comYB	125820..126851 (+)	1032	WP_272877595.1	competence type IV pilus assembly protein ComGB	Machinery gene
L6419_RS00795 (GUT184_01260)	comYC	126848..127129 (+)	282	WP_024532254.1	competence type IV pilus major pilin ComGC	Machinery gene
L6419_RS00800 (GUT184_01270)	comGD	127116..127529 (+)	414	WP_024532253.1	competence type IV pilus minor pilin ComGD	-
L6419_RS00805 (GUT184_01280)	comYE	127501..127794 (+)	294	WP_237375494.1	competence type IV pilus minor pilin ComGE	Machinery gene
L6419_RS00810 (GUT184_01290)	comGF/cglF	127781..128215 (+)	435	WP_024532251.1	competence type IV pilus minor pilin ComGF	Machinery gene
L6419_RS00815 (GUT184_01300)	comGG	128193..128606 (+)	414	WP_156011187.1	competence type IV pilus minor pilin ComGG	-
L6419_RS00820 (GUT184_01310)	comYH	128611..129564 (+)	954	WP_237375496.1	class I SAM-dependent methyltransferase	Machinery gene
L6419_RS00825 (GUT184_01320)	-	129614..130801 (+)	1188	WP_237375497.1	acetate kinase	-
L6419_RS00830 (GUT184_01330)	-	131106..131660 (+)	555	WP_024532247.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10719.63 Da
• Isoelectric Point: 9.4092

>NTDB_id=91168 L6419_RS00795 WP_024532254.1 126848..127129(+) (comYC) [Streptococcus ruminantium strain GUT-184]
MKKIIEMKNKAFTLVEMLVVLLIISVLLLLFVPNLSKHSETVQKKGNEAVVKIVESQQELYQLEHGHQPSAEELKNKGYI
TEKQLEQYQNAKK

Nucleotide

• Length: 282 bp

>NTDB_id=91168 L6419_RS00795 WP_024532254.1 126848..127129(+) (comYC) [Streptococcus ruminantium strain GUT-184]
ATGAAAAAAATCATCGAAATGAAGAATAAAGCCTTTACACTGGTAGAGATGTTAGTTGTTCTTTTAATTATTAGTGTTCT
CTTGTTGCTTTTTGTGCCGAATTTGAGTAAGCACAGCGAAACTGTCCAGAAGAAAGGAAATGAAGCGGTTGTTAAAATTG
TAGAAAGTCAGCAAGAACTCTATCAATTGGAACATGGTCATCAACCTTCAGCAGAAGAGTTAAAAAATAAAGGATACATC
ACGGAAAAACAGCTAGAGCAATATCAGAATGCGAAGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	66.667	100	0.667
comGC/cglC	Streptococcus mitis SK321	59.783	98.925	0.591
comGC/cglC	Streptococcus pneumoniae Rx1	59.14	100	0.591
comGC/cglC	Streptococcus pneumoniae D39	59.14	100	0.591
comGC/cglC	Streptococcus pneumoniae R6	59.14	100	0.591
comGC/cglC	Streptococcus mitis NCTC 12261	59.14	100	0.591
comGC/cglC	Streptococcus pneumoniae TIGR4	59.14	100	0.591
comYC	Streptococcus gordonii str. Challis substr. CH1	57.778	96.774	0.559
comGC	Lactococcus lactis subsp. cremoris KW2	54.444	96.774	0.527
comYC	Streptococcus mutans UA140	53.333	96.774	0.516
comYC	Streptococcus mutans UA159	53.333	96.774	0.516
comGC	Staphylococcus aureus N315	51.282	83.871	0.43
comGC	Staphylococcus aureus MW2	51.282	83.871	0.43
comGC	Latilactobacillus sakei subsp. sakei 23K	48.101	84.946	0.409
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398