Detailed information NTG0899260

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: R5H38_RS09330
• Genome accession: NZ_CP137602
• Coordinates: 1818924..1819208 (-)
• Length: 94 a.a.
• NCBI ID: WP_277837557.1
• Uniprot ID: -
• Organism: Streptococcus parasuis strain 221006
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1813924..1824208

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R5H38_RS09295	-	1814356..1814907 (-)	552	WP_217374325.1	folate family ECF transporter S component	-
R5H38_RS09300	-	1815162..1816349 (-)	1188	WP_318150617.1	acetate kinase	-
R5H38_RS09305	comYH	1816399..1817352 (-)	954	WP_318150618.1	class I SAM-dependent methyltransferase	Machinery gene
R5H38_RS09310	comGG	1817372..1817872 (-)	501	WP_318150619.1	competence type IV pilus minor pilin ComGG	-
R5H38_RS09315	comYF	1817850..1818308 (-)	459	WP_412080657.1	competence type IV pilus minor pilin ComGF	Machinery gene
R5H38_RS09320	comGE	1818271..1818564 (-)	294	WP_318150621.1	competence type IV pilus minor pilin ComGE	-
R5H38_RS09325	comGD	1818536..1818940 (-)	405	WP_318150622.1	competence type IV pilus minor pilin ComGD	-
R5H38_RS09330	comYC	1818924..1819208 (-)	285	WP_277837557.1	competence type IV pilus major pilin ComGC	Machinery gene
R5H38_RS09335	comYB	1819210..1820247 (-)	1038	WP_318151035.1	competence type IV pilus assembly protein ComGB	Machinery gene
R5H38_RS09340	comYA	1820159..1821109 (-)	951	WP_318150623.1	competence type IV pilus ATPase ComGA	Machinery gene
R5H38_RS09345	-	1821225..1822148 (+)	924	WP_318151036.1	LD-carboxypeptidase	-
R5H38_RS09350	-	1822208..1822549 (-)	342	WP_217374334.1	DUF1033 family protein	-
R5H38_RS09355	-	1822801..1824082 (+)	1282	Protein_1819	ISL3 family transposase	-

Sequence

Protein

• Length: 94 a.a.
• Molecular weight: 10795.03 Da
• Isoelectric Point: 10.1520

>NTDB_id=899260 R5H38_RS09330 WP_277837557.1 1818924..1819208(-) (comYC) [Streptococcus parasuis strain 221006]
MKKMLKKKVKGFTLIEMLVVLGIISILLLLFVPNLSKQKQKIQKDGNAAVVKVVESQMDIYELEHGVRPTAEELKKLEMI
TEDQLEKYNNVPKK

Nucleotide

• Length: 285 bp

>NTDB_id=899260 R5H38_RS09330 WP_277837557.1 1818924..1819208(-) (comYC) [Streptococcus parasuis strain 221006]
ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGATTCACTTTGATCGAGATGTTAGTGGTGCTTGGAATTATTAGTATTCT
CTTGCTATTATTTGTACCAAATCTCAGTAAGCAAAAGCAAAAAATACAAAAAGACGGCAATGCGGCGGTTGTAAAAGTTG
TTGAAAGTCAAATGGACATTTACGAATTGGAGCATGGTGTTCGTCCAACAGCGGAAGAATTAAAAAAATTGGAGATGATA
ACTGAAGATCAACTAGAAAAATATAATAATGTACCAAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	64.516	98.936	0.638
comGC	Lactococcus lactis subsp. cremoris KW2	57.778	95.745	0.553
comGC/cglC	Streptococcus mitis SK321	55.914	98.936	0.553
comGC/cglC	Streptococcus mitis NCTC 12261	55.435	97.872	0.543
comGC/cglC	Streptococcus pneumoniae D39	55.435	97.872	0.543
comGC/cglC	Streptococcus pneumoniae R6	55.435	97.872	0.543
comGC/cglC	Streptococcus pneumoniae TIGR4	55.435	97.872	0.543
comGC/cglC	Streptococcus pneumoniae Rx1	55.435	97.872	0.543
comYC	Streptococcus mutans UA140	55.556	95.745	0.532
comYC	Streptococcus mutans UA159	55.556	95.745	0.532
comYC	Streptococcus gordonii str. Challis substr. CH1	55.056	94.681	0.521
comGC	Latilactobacillus sakei subsp. sakei 23K	43.373	88.298	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	79.787	0.372
comGC	Staphylococcus aureus MW2	52.239	71.277	0.372
comGC	Staphylococcus aureus N315	52.239	71.277	0.372