NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	RIN70_RS01175	Genome accession	NZ_CP134147
Coordinates	203964..204281 (+)	Length	105 a.a.
NCBI ID	WP_023919650.1	Uniprot ID	-
Organism	Streptococcus parasanguinis strain 30.8.10
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 198964..209281

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RIN70_RS01155 (RIN70_01155)	-	200262..201365 (+)	1104	WP_155124981.1	glycosyl hydrolase family 8	-
RIN70_RS01160 (RIN70_01160)	-	201585..201974 (+)	390	WP_049505981.1	DUF1033 family protein	-
RIN70_RS01165 (RIN70_01165)	comYA	202062..203003 (+)	942	WP_155124982.1	competence type IV pilus ATPase ComGA	Machinery gene
RIN70_RS01170 (RIN70_01170)	comYB	202936..203967 (+)	1032	WP_195623587.1	competence type IV pilus assembly protein ComGB	Machinery gene
RIN70_RS01175 (RIN70_01175)	comYC	203964..204281 (+)	318	WP_023919650.1	competence type IV pilus major pilin ComGC	Machinery gene
RIN70_RS01180 (RIN70_01180)	comYD	204271..204675 (+)	405	WP_134974548.1	competence type IV pilus minor pilin ComGD	Machinery gene
RIN70_RS01185 (RIN70_01185)	comGE	204641..204928 (+)	288	WP_049472874.1	competence type IV pilus minor pilin ComGE	-
RIN70_RS01190 (RIN70_01190)	comGF/cglF	204918..205370 (+)	453	WP_049472872.1	competence type IV pilus minor pilin ComGF	Machinery gene
RIN70_RS01195 (RIN70_01195)	comGG	205357..205791 (+)	435	WP_313790620.1	competence type IV pilus minor pilin ComGG	-
RIN70_RS01200 (RIN70_01200)	comYH	205822..206775 (+)	954	WP_118397210.1	class I SAM-dependent methyltransferase	Machinery gene
RIN70_RS01205 (RIN70_01205)	-	206827..208020 (+)	1194	WP_003019073.1	acetate kinase	-
RIN70_RS01210 (RIN70_01210)	-	208093..208824 (+)	732	WP_049483596.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11675.59 Da Isoelectric Point: 9.6248

                                >NTDB_id=878838 RIN70_RS01175 WP_023919650.1 203964..204281(+) (comYC) [Streptococcus parasanguinis strain 30.8.10]

MKKLKTYKVKAFTLIEMLVVLLIISVLLLLFVPNLTKQKDSVKETGNAAVVKVVESQAELYELNHTNDQATLSKLIADGN

ITNKQAESYRAYYAKNSGETRAVAD

Nucleotide

Download Length: 318 bp

                                >NTDB_id=878838 RIN70_RS01175 WP_023919650.1 203964..204281(+) (comYC) [Streptococcus parasanguinis strain 30.8.10]

ATGAAAAAATTAAAAACATATAAGGTAAAAGCTTTTACGCTGATTGAAATGTTGGTGGTCTTATTGATCATCAGTGTGCT

CTTATTGCTCTTTGTGCCGAATTTGACCAAGCAAAAAGACTCTGTGAAAGAGACAGGCAATGCAGCCGTTGTCAAGGTGG

TCGAAAGTCAGGCTGAATTGTACGAGCTCAATCATACCAATGACCAAGCCACTCTATCAAAGCTAATTGCTGATGGAAAT

ATTACCAACAAACAAGCAGAATCTTATCGTGCCTATTATGCGAAAAATAGTGGAGAAACTCGTGCGGTTGCAGATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus gordonii str. Challis substr. CH1	77.143	100	0.771
comYC	Streptococcus mutans UA159	74.286	100	0.743
comYC	Streptococcus mutans UA140	74.286	100	0.743
comGC/cglC	Streptococcus mitis SK321	68.807	100	0.714
comGC/cglC	Streptococcus mitis NCTC 12261	67.273	100	0.705
comGC/cglC	Streptococcus pneumoniae Rx1	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae R6	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae TIGR4	65.138	100	0.676
comGC/cglC	Streptococcus pneumoniae D39	65.138	100	0.676
comGC	Lactococcus lactis subsp. cremoris KW2	60.577	99.048	0.6
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Staphylococcus aureus N315	45.918	93.333	0.429
comGC	Staphylococcus aureus MW2	45.918	93.333	0.429

Detailed information NTG0878838